Содержание

Как нарисовать электрическую схему на компьютере — обзор программ. Как нарисовать электрическую схему в Word Рисование электрических схем

Мы все больше пользуемся компьютером и виртуальными инструментами. Вот уже и чертить на бумаге схемы не всегда хочется — долго, не всегда красиво и исправлять сложно. Кроме того, программа для рисования схем может выдать перечень необходимых элементов, смоделировать печатную плату, а некоторые могут даже просчитать результаты ее работы.

Бесплатные программы для создания схем

В сети имеется немало неплохих бесплатных программ для рисования электрических схем. Профессионалам их функционала может быть недостаточно, но для создания схемы электроснабжения дома или квартиры, их функций и операций хватит с головой. Не все они в равной мере удобны, есть сложные в освоении, но можно найти несколько бесплатных программ для рисования электросхем которыми сможет пользоваться любой, настолько в них простой и понятный интерфейс.

Самый простой вариант — использовать штатную программу Windows Paint, которая есть практически на любом компьютере. Но в этом случае вам придется все элементы прорисовывать самостоятельно. Специальная программа для рисования схем позволяет вставлять готовые элементы на нужные места, а потом соединять их при помощи линий связи. ОБ этих программах и поговорим дальше.

Бесплатная программа для рисования схем — не значит плохая. На данном фото работа с Fritzing

Программа для рисования схем QElectroTech есть на русском языке, причем русифицирована она полностью — меню, пояснения — на русском языке. Удобный и понятный интерфейс — иерархическое меню с возможными элементами и операциями в левой части экрана и несколько вкладок вверху. Есть также кнопки быстрого доступа для выполнения стандартных операций — сохранения, вывода на печать и т.п.

Имеется обширный перечень готовых элементов, есть возможность рисовать геометрические фигуры, вставлять текст, вносить изменения на определенном участке, изменять в каком-то отдельно взятом фрагменте направление, добавлять строки и столбцы.

В общем, довольно удобна программа при помощи которой легко нарисовать схему электроснабжения, проставить наименование элементов и номиналы. Результат можно сохранить в нескольких форматах: JPG, PNG, BMP, SVG, импортировать данные (открыть в данной программе) можно в форматах QET и XML, экспортировать — в формате QET.

Недостаток этой программы для рисования схем — отсутствие видео на русском языке о том, как ей пользоваться, зато есть немалое количество уроков на других языках.

Графический редактор от Майкрософт — Visio

Для тех, кто имеет хоть небольшой опыт работы с продуктами Майкрософт, освоить работу в из графическом редакторе Visio (Визио) будет несложно. У данного продукта также есть полностью русифицированная версия, причем с хорошим уровнем перевода.

Данный продукт позволяет начертить схему в масштабе, что удобно для расчета количества необходимых проводов. Большая библиотека трафаретов с условными обозначениями, различных составляющих схемы, делает работу похожей на сборку конструктора: необходимо найти нужный элемент и поставить его на место. Так как к работе в программах данного типа многие привыкли, сложности поиск не представляет.

К положительным моментам можно отнести наличие приличного количества уроков по работе с этой программой для рисования схем, причем на русском языке.

Компас Электрик

Еще одна программа для рисования схем на компьютере — Компас Электрик. Это уже более серьезный продукт, который используют профессионалы. Имеется широкий функционал, позволяющий рисовать различные планы, блок-схемы, другие подобные рисунки. При переносе схемы в программу параллельно формируется спецификация и монтажная схема и све они выдаются на печать.

Для начала работы необходимо подгрузить библиотеку с элементами системы. При выборе схематичного изображения того или иного элемента будет «выскакивать» окно, в котором будет список подходящих деталей, взятый из библиотеки. Из данного списка выбирают подходящий элемент, после чего его схематичное изображение появляется в указанном месте схемы. В то же время автоматически проставляется соответствующее ГОСТу обозначение со сквозной нумерацией (цифры программа меняет сама). В то же время в спецификации появляются параметры (название, номер, номинал) выбранного элемента.

В общем, программа интересная и полезная для разработки схем устройств. Может применяться для создания схемы электропроводки в доме или квартире, но в этом случае ее функционал использован почти не будет. И еще один положительный момент: есть много видео-уроков работы с Компас-Электрик, так что освоить ее будет несложно.

Программа DipTrace — для рисования однолинейных схем и принципиальных

Эта программа полезна не только для рисования схем электроснабжения — тут все просто, так как нужна только схема. Более полезна она для разработки плат, так как имеет встроенную функцию преобразования имеющейся схемы в трассу для печатной платы.

Для начала работы, как и в многих других случаях, необходимо сначала подгрузить имеющиеся на вашем компьютере библиотеки с элементной базой. Для этого необходимо запустить приложение Schematic DT, после чего можно загрузить библиотеки. Их можно будет скачать на том же ресурсе, где будете брать программу.

После загрузки библиотеки можно приступать к рисованию схемы. Сначала можно «перетащить» нужные элементы из библиотек на рабочее поле, развернуть их (если понадобится), расставить и связать линиями связи. После того как схема готова, если необходимо, в меню выбираем строку «преобразовать в плату» и ждем некоторое время. На выходе будет готовая печатная плата с расположением элементов и дорожек. Также можно в 3D варианте посмотреть внешний вид готовой платы.

Бесплатная прога ProfiCAD для составления электросхем

Бесплатная программа для рисования схем ProfiCAD — один из лучших вариантов для домашнего мастера. Она проста в работе, не требует наличия на компьютере специальных библиотек — в ней уже есть коло 700 элементов. Если их недостаточно, можно легко пополнить базу. Требуемый элемент можно просто «перетащить» на поле, там развернуть в нужном направлении, установить.

Отрисовав схему, можно получить таблицу соединений, ведомость материалов, список проводов. Результаты можно получить в одном из четырех наиболее распространенных форматов: PNG, EMF, BMP, DXF. Приятная особенность этой программы — она имеет низкие аппаратные требования. Она нормально работает с системами от Windows 2000 и выше.

Есть у этого продукта только один недостаток — пока нет видео о работе с ней на русском языке. Но интерфейс настолько понятный, что разобраться можно и самому, или посмотреть один из «импортных» роликов чтобы понять механику работы.

Если вам придется часто работать с программой для рисования схем, стоит рассмотреть некоторые платные версии. Чем они лучше? У них более широкий функционал, иногда более обширные библиотеки и более продуманный интерфейс.

Простая и удобная sPlan

Если вам не очень хочется разбираться с тонкостями работы с многоуровневыми программм, присмотритесь к пролукту sPlan. Он имеет очень простое и понятное устройство, так что через час-полтора работы вы будете уже свободно ориентироваться.

Как обычно в таких программах, необходима библиотека элементов, после первого пуска их надо подгрузить перед началом работы.

В дальнейшем, если не будете переносить библиотеку в другое место, настройка не нужна — старый путь к ней используется по умолчанию.

Если вам необходим элемент, которого нет в списке, его можно нарисовать, затем добавить в библиотеку. Также есть возможность вставлять посторонние изображения и сохранять их, при необходимости, в библиотеке.

Из других полезных и нужных функций — автонумерация, возможность изменения масштаба элемента при помощи вращения колесика мышки, линейки для более понятного масштабирования. В общем, приятная и полезная вещь.

Micro-Cap

Эта программа кроме построения схемы любого типа (аналогового, цифрового или смешанного) позволяет еще и проанализировать ее работу. Задаются исходные параметры и получаете выходные данные. То есть, можно моделировать работу схемы при различных условиях. Очень полезная возможность, потому, наверное, ее очень любят преподаватели, да и студенты.

В программе Micro-Cap есть встроенные библиотеки, которые можно пополнять при помощи специальной функции. При рисовании электрической схемы продукт в автоматическом режиме разрабатывает уравнения цепи, также проводит расчет в зависимости от проставленных номиналов. При изменении номинала, изменение выходных параметров происходит тут же.

Программа для черчения схем электроснабжения и не только — больше для симуляции их работы

Номиналы элементов могут быть постоянными или переменными, зависящими от различных факторов — температуры, времени, частоты, состояния некоторых элементов схемы и т.д. Все эти варианты просчитываются, результаты выдаются в удобном виде. Если есть в схеме детали, которые изменяют вид или состояние — светодиоды, реле — при симуляции работы, изменяют свои параметры и внешний вид благодаря анимации.

Программа для черчения и анализа схем Micro-Cap платная, в оригинале — англоязычная, но есть и русифицированная версия. Стоимость ее в профессиональном варианте — больше тысячи долларов. Хороша новость в том, что есть и бесплатная версия, как водится с урезанными возможностями (меньшая библиотека, не более 50 элементов в схеме, сниженная скорость работы). Для домашнего пользования вполне подойдет и такой вариант. Приятно еще что она нормально работает с любой системой Windows от Vista и 7 и выше.

На сегодняшний день черчение электросхем вручную на листике уже не использует ни один опытный электрик. Гораздо проще, удобнее и понятнее составить проект электропроводки помещения на компьютере через специальный программный пакет на русском языке. Однако проблема в том, что далеко не все программы простые в использовании, поэтому наткнувшись на неудобную и к тому же платную версию программного обеспечения, большинство мастеров старой закалки просто отбрасывают современный способ моделирования в сторону. Далее мы предоставим читателям сайта обзор самых простых программ для черчения электрических схем квартир и домов на компьютере.

Бесплатные ПО

Существует не так много русскоязычных, удобных в использовании и к тому же бесплатных ПО для составления однолинейных электросхем на компьютере. Итак, мы создали небольшой рейтинг, чтобы Вам стало известно, какие программы лучше для рисования схем электроснабжения домов и квартир:

  1. . Как ни странно, но наиболее популярной и что не менее важно – бесплатной программой для черчения однолинейных электрических схем на компьютере является векторный графический редактор Visio. С его помощью даже начинающий электрик сможет быстро нарисовать принципиальную электросхему дома либо квартиры. Что касается функциональных возможностей, они не настолько расширенные, нежели у ПО, которые мы предоставим ниже. Подведя итог можно сказать, что Microsoft Visio это легкая в использовании и при этом на русском языке бесплатная программа для моделирования электрических цепей, которая подойдет домашним электрикам.
  2. . Более профессиональный программный пакет для проектирования схем электроснабжения помещений. В Компасе существует собственная база данных, в которой хранятся наименования и номиналы всех наиболее популярных типов автоматики, релейной защиты, низковольтных установок и других элементов цепи. Помимо этого в базе данных заложены графические обозначения всех этих элементов, что позволит сделать понятную схему электроснабжения либо даже отдельного распределительного щита. ПО полностью на русском языке и к тому же можно скачать его бесплатно.
  3. Eagle (Easily Applicable Graphical Layout Editor). Этот программный пакет позволит не только рисовать однолинейные схемы электроснабжения, но и самостоятельно разработать чертеж печатной платы. Что касается последнего, то черчение можно осуществлять как вручную, так и без собственного участия (в автоматическом режиме). На сегодняшний день существует как платная, так и бесплатная версия программы Eagle. Для домашнего использования достаточно будет скачать версию с обозначением «Freeware» (присутствуют некоторые ограничения по отношению к максимальному размеру полезной площади печатной платы). Недостаток данного программного пакета в том, что он официально не русифицирован, хотя если немного постараться, в интернете можно найти русификатор, что позволит без препятствий чертить электрические схемы квартир и домов.
  4. Dip Trace . Еще одна популярная программа для черчения электросхем и создания трасс для печатных плат. Программа простая и удобная в использовании, к тому же полностью на русском языке. Интерфейс позволяет спроектировать печатную плату в объемном виде, используя базу данных с уже готовыми элементами электрической цепи. Оценить полный функционал ПО Вы сможете только за деньги, но существует и урезанная бесплатная версия, которой будет вполне достаточно начинающему электрику.
  5. ». Полностью бесплатная программа для черчения электрических схем на компьютере. С официального сайта Вы можете скачать ее на русском языке и полной версией. Помимо моделирования проектов электроснабжения квартир, домов и других видов помещений, в данном программном пакете можно запросто составить схему , в которой сразу же будут предоставлены наиболее подходящие номиналы автоматов, релейной защиты и т.д. Приятным дополнением в данном ПО является база данных с наклейками, которые можно распечатать и расклеить в собственном распределительном щитке для графического обозначения всех элементов цепи по госту.
  6. . Одной из бесплатных версий популярного редактора Автокад является AutoCAD Electrician. Вкратце об этом ПО можно сказать следующее: функционал подойдет как для начинающих, так и для профессиональных электриков, работающих в области энергетики. В интерфейсе все просто, разобраться можно быстро. Все функции на русском языке, поэтому можно без проблем использовать Автокад для черчения электрических схем разводки электропроводки по дому либо квартире.
  7. Эльф . Интересное название простенькой программы для моделирования схем электроснабжения в строительном черчении. Сам программный пакет не менее интересный и многофункциональный. С помощью программки «Эльф проектирование» можно выполнить построение чертежей электроснабжения любой сложности. Помимо этого ПО помогает подходящего номинала, и т.д. «Эльф проектирование» полностью бесплатный программный пакет на русском языке.

Некоторые из перечисленных программ вы можете увидеть на видео обзорах:

AutoCAD Electrical

КОМПАС-Электрик

Помимо предоставленных 7 программ для черчения электросхем существует еще более десятка редакторов, в которых можно бесплатно составить принципиальный план электроснабжения дома либо квартиры, однако в остальных программках более сложный интерфейс либо проблемы с русскоязычной версией. Рекомендуем отдавать предпочтение представителям данного рейтинга, чтобы в дальнейшем не тратить время на поиск русификаторов, руководств по использованию и тому подобное!

Платные ПО

Бесплатные программки для составления электросхем своими силами мы рассмотрели. Однако Вы сами понимаете, что в платных версиях предоставлен более широкий набор возможностей и удобных дополнений, которые позволят начертить эл схему на компьютере. Существует множество популярных платных программ для черчения электрических схем. Некоторые из них мы предоставили выше, однако существует еще одна программка, о которой стоит немного рассказать — sPlan . Это один из самых простейших в использовании и к тому же многофункциональных программных пакетов для составления схем разводки электропроводки и трассировки электронных плат. Интерфейс удобный, на русском языке. В базе данных заложены все самые популярные графические элементы для черчения электросхем.

Если Вам не жалко потратить 40$ за лицензию, мы настоятельно рекомендуем выбрать для черчения именно sPlan. Данное ПО без сомнений подойдет как для домашнего использования, так и для профессиональных проектировочных работ в чем Вы можете убедиться, просмотрев данное видео:

Правильное пользование sPlan

Вот мы и предоставили обзор самых лучших платных и бесплатных программ для черчения электрических схем на компьютере. Кстати, на телефон (на андроид) Вы можете скачать приложение «Мобильный электрик», в котором можно запросто произвести расчет основных элементов электрической цепи, который поможет правильно составить электросхему, если компьютера нет рядом!

Похожие материалы:

У меня уже давно созревала эта статья, а тут как раз сегодня попросили описать процесс создания электрических схем в текстовом редакторе Word . Существует много программ для создания электрических схем, но они в основном платные и довольно-таки сложные. Поэтому будем искать другую альтернативу.

Можно создать маленькие шаблончики рисунков отдельных элементов будущей схемы, и вставлять их потом в свой чертеж, но это очень долго и муторно. А главный минус , что эти шаблоны не будут соответствовать ГОСТу.

Есть другой вариант – скачатьплагин (cкачиваний: 5484) (макрос) для создания электрических схем, и уже с его помощью создавать схему.

Распакуйте архив в отдельную папочку.

Откройте новый документ в Word. Перейдите в меню Файл Открыть . В открывшемся окне Открытие документа установите Тип файлов Шаблоны документов (*. dot ) , выберите файл Electro . dot , и нажмите кнопку Открыть .

У вас появиться новая панель. Нас в данном случае будет больше интересовать выпадающий список Схема .

В Word 2007/2010 панель будет выглядеть немного по-другому, но сама суть не измениться.

Если у вас не появилась такая панель, то войдите в меню Вид – Панели инструментов, и установите галочки на панель Стандартная NEW и Форматирование NEW .

Сразу хочу предупредить, что есть одно неудобство. Файл сохраняется только при выходе из программы. Потому, что нужно настраивать макросы, а это уже другая тема.

В списке Схема имеются самые необходимые инструменты. Но для связки их, вам надо использовать инструменты обычной вордовской панели Рисование Автофигуры: Линии, Соединительные линии и т.п.

Достоинства:
– нет необходимости устанавливать специальные программы;
– простота создания несложных электрических схем;
– бесплатное распространение описанного шаблона;
– возможность сохранения схемы в форматах pdf, html.
Недостатки:
– сложность создания электрических схем по ГОСТу;
– при открытии файла со схемой в других версиях Word возможно нарушения форматирования документа;
– небольшой набор компонентов для рисования электрических схем.

Мы все больше пользуемся компьютером и виртуальными инструментами. Вот уже и чертить на бумаге схемы не всегда хочется — долго, не всегда красиво и исправлять сложно. Кроме того, программа для рисования схем может выдать перечень необходимых элементов, смоделировать печатную плату, а некоторые могут даже просчитать результаты ее работы.

Бесплатные программы для создания схем

В сети имеется немало неплохих бесплатных программ для рисования электрических схем. Профессионалам их функционала может быть недостаточно, но для создания схемы электроснабжения дома или квартиры, их функций и операций хватит с головой. Не все они в равной мере удобны, есть сложные в освоении, но можно найти несколько бесплатных программ для рисования электросхем которыми сможет пользоваться любой, настолько в них простой и понятный интерфейс.

Самый простой вариант — использовать штатную программу Windows Paint, которая есть практически на любом компьютере. Но в этом случае вам придется все элементы прорисовывать самостоятельно. Специальная программа для рисования схем позволяет вставлять готовые элементы на нужные места, а потом соединять их при помощи линий связи. ОБ этих программах и поговорим дальше.

Бесплатная программа для рисования схем — не значит плохая. На данном фото работа с Fritzing

Программа для рисования схем QElectroTech есть на русском языке, причем русифицирована она полностью — меню, пояснения — на русском языке. Удобный и понятный интерфейс — иерархическое меню с возможными элементами и операциями в левой части экрана и несколько вкладок вверху. Есть также кнопки быстрого доступа для выполнения стандартных операций — сохранения, вывода на печать и т.п.

Редактор электрических схем QElectroTech

Имеется обширный перечень готовых элементов, есть возможность рисовать геометрические фигуры, вставлять текст, вносить изменения на определенном участке, изменять в каком-то отдельно взятом фрагменте направление, добавлять строки и столбцы. В общем, довольно удобна программа при помощи которой легко нарисовать схему электроснабжения, проставить наименование элементов и номиналы. Результат можно сохранить в нескольких форматах: JPG, PNG, BMP, SVG, импортировать данные (открыть в данной программе) можно в форматах QET и XML, экспортировать — в формате QET.

Недостаток этой программы для рисования схем — отсутствие видео на русском языке о том, как ей пользоваться, зато есть немалое количество уроков на других языках.

Графический редактор от Майкрософт — Visio

Для тех, кто имеет хоть небольшой опыт работы с продуктами Майкрософт, освоить работу в из графическом редакторе Visio (Визио) будет несложно. У данного продукта также есть полностью русифицированная версия, причем с хорошим уровнем перевода.

Составлять электрические схемы в Visio несложно

Данный продукт позволяет начертить схему в масштабе, что удобно для расчета количества необходимых проводов. Большая библиотека трафаретов с условными обозначениями, различных составляющих схемы, делает работу похожей на сборку конструктора: необходимо найти нужный элемент и поставить его на место. Так как к работе в программах данного типа многие привыкли, сложности поиск не представляет.

К положительным моментам можно отнести наличие приличного количества уроков по работе с этой программой для рисования схем, причем на русском языке.

Компас Электрик

Еще одна программа для рисования схем на компьютере — Компас Электрик. Это уже более серьезный продукт, который используют профессионалы. Имеется широкий функционал, позволяющий рисовать различные планы, блок-схемы, другие подобные рисунки. При переносе схемы в программу параллельно формируется спецификация и монтажная схема и све они выдаются на печать.

Для начала работы необходимо подгрузить библиотеку с элементами системы. При выборе схематичного изображения того или иного элемента будет «выскакивать» окно, в котором будет список подходящих деталей, взятый из библиотеки. Из данного списка выбирают подходящий элемент, после чего его схематичное изображение появляется в указанном месте схемы. В то же время автоматически проставляется соответствующее ГОСТу обозначение со сквозной нумерацией (цифры программа меняет сама). В то же время в спецификации появляются параметры (название, номер, номинал) выбранного элемента.

Пример схемы, созданной в Компас Электрик

В общем, программа интересная и полезная для разработки схем устройств. Может применяться для создания схемы электропроводки в доме или квартире, но в этом случае ее функционал использован почти не будет. И еще один положительный момент: есть много видео-уроков работы с Компас-Электрик, так что освоить ее будет несложно.

Программа DipTrace — для рисования однолинейных схем и принципиальных

Эта программа полезна не только для рисования схем электроснабжения — тут все просто, так как нужна только схема. Более полезна она для разработки плат, так как имеет встроенную функцию преобразования имеющейся схемы в трассу для печатной платы.

Исходная схема (мультивибратор), нарисованная а DipTrace

Схема печатной платы

Сама плата мультивибратора

Для начала работы, как и в многих других случаях, необходимо сначала подгрузить имеющиеся на вашем компьютере библиотеки с элементной базой. Для этого необходимо запустить приложение Schematic DT, после чего можно загрузить библиотеки. Их можно будет скачать на том же ресурсе, где будете брать программу.

После загрузки библиотеки можно приступать к рисованию схемы. Сначала можно «перетащить» нужные элементы из библиотек на рабочее поле, развернуть их (если понадобится), расставить и связать линиями связи. После того как схема готова, если необходимо, в меню выбираем строку «преобразовать в плату» и ждем некоторое время. На выходе будет готовая печатная плата с расположением элементов и дорожек. Также можно в 3D варианте посмотреть внешний вид готовой платы.

Бесплатная прога ProfiCAD для составления электросхем

Бесплатная программа для рисования схем ProfiCAD — один из лучших вариантов для домашнего мастера. Она проста в работе, не требует наличия на компьютере специальных библиотек — в ней уже есть коло 700 элементов. Если их недостаточно, можно легко пополнить базу. Требуемый элемент можно просто «перетащить» на поле, там развернуть в нужном направлении, установить.

Пример использования ProfiCAD для рисования электрических схем

Отрисовав схему, можно получить таблицу соединений, ведомость материалов, список проводов. Результаты можно получить в одном из четырех наиболее распространенных форматов: PNG, EMF, BMP, DXF. Приятная особенность этой программы — она имеет низкие аппаратные требования. Она нормально работает с системами от Windows 2000 и выше.

Есть у этого продукта только один недостаток — пока нет видео о работе с ней на русском языке. Но интерфейс настолько понятный, что разобраться можно и самому, или посмотреть один из «импортных» роликов чтобы понять механику работы.

Платные, на которые стоит потратиться

Если вам придется часто работать с программой для рисования схем, стоит рассмотреть некоторые платные версии. Чем они лучше? У них более широкий функционал, иногда более обширные библиотеки и более продуманный интерфейс.

Простая и удобная sPlan

Если вам не очень хочется разбираться с тонкостями работы с многоуровневыми программм, присмотритесь к пролукту sPlan. Он имеет очень простое и понятное устройство, так что через час-полтора работы вы будете уже свободно ориентироваться.

Как обычно в таких программах, необходима библиотека элементов, после первого пуска их надо подгрузить перед началом работы. В дальнейшем, если не будете переносить библиотеку в другое место, настройка не нужна — старый путь к ней используется по умолчанию.

Программа для рисования схем sPlan и ее библиотека

Если вам необходим элемент, которого нет в списке, его можно нарисовать, затем добавить в библиотеку. Также есть возможность вставлять посторонние изображения и сохранять их, при необходимости, в библиотеке.

Из других полезных и нужных функций — автонумерация, возможность изменения масштаба элемента при помощи вращения колесика мышки, линейки для более понятного масштабирования. В общем, приятная и полезная вещь.

Micro-Cap

Эта программа кроме построения схемы любого типа (аналогового, цифрового или смешанного) позволяет еще и проанализировать ее работу. Задаются исходные параметры и получаете выходные данные. То есть, можно моделировать работу схемы при различных условиях. Очень полезная возможность, потому, наверное, ее очень любят преподаватели, да и студенты.

В программе Micro-Cap есть встроенные библиотеки, которые можно пополнять при помощи специальной функции. При рисовании электрической схемы продукт в автоматическом режиме разрабатывает уравнения цепи, также проводит расчет в зависимости от проставленных номиналов. При изменении номинала, изменение выходных параметров происходит тут же.

Программа для черчения схем электроснабжения и не только — больше для симуляции их работы

Номиналы элементов могут быть постоянными или переменными, зависящими от различных факторов — температуры, времени, частоты, состояния некоторых элементов схемы и т.д. Все эти варианты просчитываются, результаты выдаются в удобном виде. Если есть в схеме детали, которые изменяют вид или состояние — светодиоды, реле — при симуляции работы, изменяют свои параметры и внешний вид благодаря анимации.

Программа для черчения и анализа схем Micro-Cap платная, в оригинале — англоязычная, но есть и русифицированная версия. Стоимость ее в профессиональном варианте — больше тысячи долларов. Хороша новость в том, что есть и бесплатная версия, как водится с урезанными возможностями (меньшая библиотека, не более 50 элементов в схеме, сниженная скорость работы). Для домашнего пользования вполне подойдет и такой вариант. Приятно еще что она нормально работает с любой системой Windows от Vista и 7 и выше.

Времена применения кульманов давно миновали, их заменили графические редакторы, это специальные программы для черчения электрических схем. Среди них есть как платные приложения, так и бесплатные (виды лицензий мы рассмотрим ниже). Уверены, что созданный нами краткий обзор поможет из разнообразия программных продуктов выбрать ПО, наиболее оптимальное для поставленной задачи. Начнем с бесплатных версий.

Бесплатные

Прежде, чем перейти к описанию программ кратко расскажем о бесплатных лицензиях, наиболее распространены из них следующие:

  • Freeware – приложение не ограничено по функциональности и может использоваться в личных целях без коммерческой составляющей.
  • Open Source – продукт с «открытым кодом», в который допускается вносить изменения подстраивая ПО под собственные задачи. Возможны ограничения на коммерческое использование и платное распространение внесенных модификаций.
  • GNU GPL – лицензия практически не накладывающая на пользователя никаких ограничений.
  • Public domain – практически идентична с предыдущим вариантом, на данный тип лицензии закон защиты авторских прав не распространяется.
  • Ad-supported – приложение полностью функционально, содержит в себе рекламу других продуктов разработчика или других компаний.
  • Donationware – продукт распространяется бесплатно, но разработчик предлагает внести пожертвования на добровольной основе для дальнейшего развития проекта.

Получив представление о бесплатных лицензиях можно переходить к ПО, распространяемому на таких условиях.

Microsoft Visio

Это простой в управлении, но в то же время весьма удобный редактор векторной графики, обладающий богатым функциональным набором. Несмотря на то, что основная социализация программы визуализация информации с приложений MS Office, ее вполне можно использовать для просмотра и распечатки радиосхем.

MS выпускает три платных версии, отличающихся функциональным набором и бесплатную (Viewer), которая интегрируется в браузер IE и позволяет с его помощью осуществлять просмотр файлов, созданных в редакторе. К сожалению, для редакции и создания новых схем потребуется приобрести полнофункциональный продукт. Заметим, что даже в платных версиях среди базовых шаблонов нет набора для полноценного создания радиосхем, но его несложно найти и установить.

Недостатки бесплатной версии:

  • Недоступны функции редактирования и создания схем, что существенно снижает интерес к этому продукту.
  • Программа работает только с браузером IE, что также создает массу неудобств.

Компас-Электрик

Данная ПО является приложением к САПР российского разработчика «АСКОН». Для ее работы требуется установка среды КОМПАС-3D. Поскольку это отечественный продукт, в нем полностью реализована поддержка принятых России ГОСТов, и, соответственно, нет проблем с локализацией.


Приложение предназначено для проектирования любых видов электрооборудования и создания к ним комплектов конструкторской документации.

Это платное ПО, но разработчик дает 60 дней на ознакомление с системой, в течение этого времени ограничения по функциональности отсутствуют. На официальном сайте и в сети можно найти множество видео материалов, позволяющих детально ознакомиться с программным продуктом.

В отзывах многие пользователи отмечают, что в системе имеется масса недоработок, которые разработчик не спешит устранять.

Eagle

Данное ПО представляет собой комплексную среду, в которой можно создать как принципиальную схему, так и макет печатной платы к ней. То есть, расположить на плате все необходимые элементы и выполнить трассировку. При этом, она может быть выполнена как в автоматическом, так и ручном режиме или путем комбинации этих двух способов.


В базовом наборе элементов отсутствуют модели отечественных радиокомпонентов, но их шаблоны могут быть скачены в сети. Язык приложения – Английский, но локализаторы, позволяющие установить русский язык.

Приложение является платным, но возможность его бесплатного использования со следующими функциональными ограничениями:

  • Размер монтажной платы не может превышать размера 10,0х8,0 см.
  • При разводке можно манипулировать только двумя слоями.
  • В редакторе допускается работа только с одним листом.

Dip Trace

Это не отдельное приложение, а целый программный комплекс, включающий в себя:

  • Многофункциональный редактор для разработки принципиальных схем.
  • Приложение для создания монтажных плат.
  • 3D модуль, позволяющий проектировать корпуса для созданных в системе приборов.
  • Программу для создания и редактирования компонентов.

В бесплатной версии программного комплекса, для некоммерческого использования, предусмотрены небольшие ограничения:

  • Монтажная плата не более 4-х слоев.
  • Не более одной тысячи выводов с компонентов.

В программе не предусмотрена русская локализация, но ее, а также описание всех функций программного продукта можно найти в сети. С базой компонентов также нет проблем, в изначально их около 100 тыс. На тематических форумах можно найти созданные пользователями базы компонентов, в том числе и под российские ГОСТы.

1-2-3 схема

Это полностью бесплатное приложение, позволяющее укомплектовать электрощиты Хагер (Hager) одноименным оборудованием.


Функциональные возможности программы:

  • Выбор корпуса для электрощита, отвечающего нормам по степени защиты. Выборка производится из модельного ряда Hager.
  • Комплектация защитным и коммутационным модульным оборудованием того же производителя. Заметим, что в элементной базе присутствуют только сертифицированные в России модели.
  • Формирование конструкторской документации (однолинейной схемы, спецификации, отвечающей нормам ЕСКД, отрисовка внешнего вида).
  • Создание маркеров для коммутирующих устройств электрощита.

Программа полностью локализована под русский язык, единственный ее недостаток, что в элементной базе присутствует только электрооборудование компании-разработчика.

Autocad Electrical

Приложение на базе известной САПР Autocad, созданное для проектирования электросхем и создания для них технической документации в соответствии с нормами ЕСКД.


Изначально база данных включает в себя свыше двух тысяч компонентов, при этом, их условно графические обозначения отвечают действующим российским и европейским стандартам.

Данное приложение платное, но имеется возможность в течение 30-ти дней ознакомиться с полным функционалом базовой рабочей версии.

Эльф

Данное ПО позиционируется в качестве автоматизированного рабочего места (АРМ) для проектировщиков-электриков. Приложение позволяет быстро и корректно разработать, практически, любой чертеж для электротехнических проектов с привязкой к плану помещений.

Функционал приложения включает в себя:

  • Расстановку УГО при проектировании электросетей, проложенных открыто, в трубах или специальных конструкциях.
  • Автоматический (с плана) или руной расчет силовой схемы.
  • Составление спецификации в соответствии с действующими нормами.
  • Возможность расширения базы элементов (УГО).

В бесплатной демонстрационной версии отсутствует возможность создания и редактирование проектов, их можно только просмотреть или распечатать.

Kicad

Это полностью бесплатный программный комплекс с открытым кодом (Open Source). Данное ПО позиционируется в качестве системы сквозного проектирования. То есть, можно разработать принципиальную схему, по ней создать монтажную плату и подготовить документацию, необходимую для производства.


Характерные особенности системы:

  • Для разводки платы допускается применение внешних трассировщиков.
  • В программу встроен калькулятор печатной платы, размещение на ней элементов можно выполнить автоматически или вручную.
  • По завершению трассировки система генерирует несколько технологических файлов (например, для фотоплоттера, сверлильного станка и т.д.). При желании можно добавить логотип компании на печатную плату.
  • Система может создать послойную распечатку в нескольких популярных форматах, а также сгенерировать список используемых в разработке компонентов для формирования заказа.
  • Имеется возможность экспорт чертежей и других документов в форматы pdf и dxf.

Заметим, что многие пользователи отмечают непродуманность интерфейса системы, а также тот факт, что для освоения ПО требуется хорошо изучить документацию к программе.

TinyCAD

Еще одно бесплатное приложение с открытым кодом, позволяющее создавать чертежи принципиальных схем и имеющее функции простого редактора векторной графики. В базовом наборе содержится сорок различных библиотек компонентов.


TinyCAD – простой редактор для принципиальных схем

В программе не предусмотрена трассировка печатных плат, но имеется возможность экспортировать список соединений в стороннее приложение. Экспорт производится с поддержкой распространенных расширений.

Приложение поддерживает только английский язык, но благодаря интуитивному меню проблем с освоением не возникнет.

Fritzing

Бесплатная среда разработки проектов на базе Arduino. Имеется возможность создания печатных плат (разводку необходимо делать вручную, поскольку функция автотрассировки откровенно слабая).


Следует заметить, что приложение «заточено» для быстрого создания набросков, позволяющих объяснить принцип работы проектируемого прибора. Для серьезной работы у приложения слишком мала база элементов и сильно упрощенное составление схемы.

123D Circuits

Это веб-приложение для разработки Arduino-проектов, с возможностью программирования устройства, симуляции и анализа его работы. В типовом наборе элементов присутствуют только основные радио-компоненты и модули Arduino. При необходимости пользователь может создать новые компоненты и добавить их в базу. Примечательно, что разработанную печатную плату можно заказать, непосредственно, в онлайн-сервисе.


В бесплатной версии сервиса нельзя создавать свои проекты, но можно просматривать чужие разработки, находящиеся в открытом доступе. Для полноценного доступа ко всем возможностям необходимо оформить подписку ($12 или $24 в месяц).

Заметим, что из-за бедного функционала виртуальная среда разработки вызывает интерес только у начинающих. Многие из тех, кто пользовался сервисом, обратили внимание на тот факт, что результаты симуляции расходятся с реальными показателями.

XCircuit

Бесплатное мультиплатформенное приложение (лицензия GNU GPL) для быстрого создания принципиальных схем. Функциональный набор минимальный.


Язык приложения – английский, программа не воспринимает русские символы. Также следует обратить внимание на нетипичное меню, к которому необходимо привыкнуть. Помимо этого контекстные подсказки выводятся на панель состояния. В базовый набор элементов входят УГО только основных радиодеталей (пользователь может создать свои элементы и добавить их).

CADSTAR Express

Это демонстрационная версия одноименной САПР. Функциональные ограничения коснулись лишь числа элементов, используемых в схеме разработки (до 50 шт) и количеств контактов (не более 300), что вполне достаточно для небольших радиолюбительских проектов.


Программа состоит из центрального модуля, в которых входит несколько приложений позволяющих разработать схему, создать для нее плату и подготовить пакет технической документации.

В базовый набор входит более 20 тыс. компонентов, дополнительно можно загрузить с сайта разработчика дополнительные библиотеки.

Существенным недостатком системы является отсутствие поддержки русского языка, соответственно, все техническая документация также представлена в сети на английском.

QElectroTech

Простое удобное и бесплатное (FreeWare) приложения для разработки электрических и электронных схем-чертежей. Программа является обычным редактором, никаких специальных функций в ней не реализовано.


Язык приложения – английский, но для него имеется русская локализация.

Платные приложения

В отличие от ПО, распространяемого по бесплатным лицензиям, коммерческие программы, как правило, обладают значительно большим функционалом, и поддерживаются разработчиками. В качестве примера мы приведем несколько таких приложений.

sPlan

Простая программа-редактор для черчения электросхем. Приложение комплектуется несколькими библиотеками компонентов, которые пользователь может расширять по мере необходимости. Допускается одновременная работа с несколькими проектами, путем их открытия в отдельных вкладках.


Чертежи, сделанные программой, хранятся в виде файлов векторной графики собственного формата с расширением «spl». Допускается конвертация в типовые растровые форматы изображения. Имеется возможность печати больших схем на обычном принтере А4-го формата.

Официально приложение не выпускается в русской локализации, но существуют программы, позволяющие русифицировать меню и контекстные подсказки.

Помимо платной версии предусмотрены две бесплатных реализации Demo и Viewer. В первой нет возможности сохранить и распечатать нарисованную схему. Во второй предусмотрена только функция просмотра и печати файлов формата «spl».

Eplan Electric

Многомодульная масштабируемая САПР для разработки электротехнических проектов различной сложности и автоматизации процесса подготовки конструкторской документации. Данный программный комплекс сейчас позиционируется в качестве корпоративного решения, поэтому для рядовых пользователей он будет не интересен, особенно если принять в учет стоимость ПО.


Target 3001

Мощный САПР комплекс, позволяющий разрабатывать электросхемы, трассировать печатные платы, моделировать работу электронных устройств. Онлайн библиотека компонентов насчитывает более 36 тыс. различных элементов. Данная CAD широко применяется в Европе для трассировки печатных плат.


По умолчанию устанавливается английский язык, имеется возможность установить меню на немецком или французском, официально русской локализации нет. Соответственно, вся документация представлена только на английском, французском или немецком языке.

Стоимость самой простой базовой версии около 70 евро. За эти деньги будет доступна трассировка двух слоев на 400 выводов. Стоимость нелимитированной версии в районе 3,6 тыс. евро.

Micro-Cap

Приложение для моделирования цифровых, аналоговых и смешанных схем, а также анализа их работы. Пользователь может создать в редакторе электрическую цепь и задать параметры для анализа. После это по одному клику мышки система автоматически чего произведет необходимые расчеты и выдаст результаты для изучения.


Программа позволяет установить зависимость параметров (номиналов) элементов от температурного режима, освещенности, частотных характеристик и т.д. Если в схеме присутствуют анимированные элементы, например, светодиодные индикаторы, то их состояние будут корректно отображаться, в зависимости от поступающих сигналов. Имеется возможность при моделировании «подключать» к схеме виртуальные измерительные приборы, а также отслеживать состояние различных узлов устройства.

Стоимость полнофункциональной версии около $4,5 тыс. Официальной русской локализации приложения не существует.

TurboCAD

Данная САПР платформа включает в себя множество инструментов, для проектирования различных электрических устройств. Набор специальных функций позволяет решать инженерно-конструкторские задачи любого уровня сложности.


Отличительные особенности – тонкая настройка интерфейса под пользователя. Множество справочной литературы, в том числе и на русском языке. Несмотря на отсутствие официальной поддержки русского языка, для платформы имеются русификаторы.

Для рядовых пользователей приобретение платной версии программы с целью разработки электросхем для любительских устройств, будет нерентабельно.

Designer Schematic

Приложение для создания электросхем с использованием радиоэлементов производства Digi-Key. Основная особенность данной системы заключается в том, что в редакторе для построения схем, может использовать механическое проектирование.


Базы данных компонентов можно в любой момент проверить на соответствие и при необходимости произвести обновление прямо с сайта производителя.

Система не имеет собственного трассировщика, но список соединений может быть загружен в стороннюю программу.

Имеется возможность импорта файлов из популярных САПР.

Ориентировочная стоимость приложения около $300.

▶▷▶▷ программа составления однолинейных электрических схем

▶▷▶▷ программа составления однолинейных электрических схем
ИнтерфейсРусский/Английский
Тип лицензияFree
Кол-во просмотров257
Кол-во загрузок132 раз
Обновление:05-04-2019

программа составления однолинейных электрических схем – Программа Составления Однолинейных Электрических Схем bookcurrentweeblycomblogprogramma Cached Конструктор однолинейных электрических схем Однолинейных Схем Составления схем Программа КОМПАС-3d Такие комплекты для черчения электрических схем будет полезен Бесплатная программа для рисования электрических схем wwwyoutubecom watch?vMpgGSTrJXJc Cached Бесплатная программа для рисования электрических схем SoftFlyru Моделирование электронных схем в Multisim Программа Составления Однолинейных Электрических Схем – Image Results More Программа Составления Однолинейных Электрических Схем images Программы для черчения электрических схем квартир и домов samelectrikruobzor-luchshix-programm-dlya Cached Как ни странно, но наиболее популярной и что не менее важно бесплатной программой для черчения однолинейных электрических схем на компьютере является векторный графический редактор Visio Программа для черчения электрических схем: какой выбрать etotdomcomremontprogramma-dlya-elektricheskix-sxem Cached Программа для электрических схем это инструмент, используемый инженерами, для создания электронных схем с целью расчета и тестирования изделий на этапах проектирования, производства, а также эксплуатации Программы для черчения электрических схем cxemnetsoftwaresoft_sketchphp Cached Программа полностью на русском языке Редактор электрических схем рассчитан на Программа Для Составления Однолинейных Схем – booksinstitute booksinstituteweeblycomblogprogramma-dlya Cached Программа для электрических схем плюсы и минусы Visio, QElectroTech Для Составления Программа Для Составления Однолинейных Схем – spisoklicious spisokliciousweeblycomblogprogramma-dlya Cached ДНД Конструктор Однолинейных Схем это программный комплекс, предназначенный Программа создана только для составления однолинейных Программа Составления Однолинейных Электрических Схем lettercove235weeblycomblogprogramma Cached Программа Составления Однолинейных Электрических Схем виды электрических схем , в том Программа Составления Однолинейных Электрических Схем chatessentialweeblycomblogprogramma Cached Форумы сайта электрик gt программа Можно найти программу для рисования электрических схем Программа Составления Однолинейных Электрических Схем – softspice softspiceweeblycomblogprogramma-sostavleniya Cached Добрый день, GOST Electro for Visio брал для составления схем по схемотехнике, Давно искал аналогичную программу, пытался и автокад и нам работу по разработке однолинейных электрических схем Promotional Results For You Free Download Mozilla Firefox Web Browser wwwmozillaorg Download Firefox – the faster, smarter, easier way to browse the web and all of 1 2 3 4 5 Next 2,680

  • Информация о программах Академии САПР и ГИС по обучению и повышению квалификации специалистов. Биржа
  • труда проектировщиков. Каталог организаций и предприятий. Чертежи, нормативная документация, литература, пособия, утилиты, программы для AutoCAD. Оказание услуг по сверке и составлению однолинейных
  • тура, пособия, утилиты, программы для AutoCAD. Оказание услуг по сверке и составлению однолинейных электрических схем электрооборудования здания Арбитражного суда Свердловской области. Сведения о связи с позицией плана-графика. Знание ПУЭ, ПТЭЭП, современных схем электро снабжения зданий, диспетчеризации, КИПа. опыт проектирования внутреннего электроснабжения. …электро оборудования, организация ППР и текущего ремонта, проектирование внутреннего электроснабжения, составление схем электроснабжения, однолинейных электрических схем,… Промо-программы. Создание принципиальной схемы распределительной и питающей сетей; Составление силовых однолинейных схем; Создание однолинейных расчетных схем; Подведение итогов 13.00 ЗАВЕРШЕНИЕ РАБОТЫ КОНФЕРЕНЦИИ. Деловая программа научно технической конференции современные технологии строительства и ремонта трубопроводов. ФГОС и программы общего образования. Русский язык: избранные ресурсы. К составлению аналитических справок подключится также Федеральный институт педагогических измерений. …Первушин А. …. 187 Метод автоматической разметки предложения для этапа синтаксической сегментации, Манушкин Е.С. … 191 Метод формирования модели глагольного управления для русского языка, Кочеткова Н.А. … 199 Параллельный алгоритм составления…

пособия

Манушкин Е.С. … 191 Метод формирования модели глагольного управления для русского языка

  • пытался и автокад и нам работу по разработке однолинейных электрических схем Promotional Results For You Free Download Mozilla Firefox Web Browser wwwmozillaorg Download Firefox – the faster
  • QElectroTech Для Составления Программа Для Составления Однолинейных Схем – spisoklicious spisokliciousweeblycomblogprogramma-dlya Cached ДНД Конструктор Однолинейных Схем это программный комплекс
  • QElectroTech Для Составления Программа Для Составления Однолинейных Схем – spisoklicious spisokliciousweeblycomblogprogramma-dlya Cached ДНД Конструктор Однолинейных Схем это программный комплекс

программа составления однолинейных электрических схем Все результаты Программа для электриков Elproject для разработки однолинейных окт г сообщений автора Программа Elproject предназначена для разработки принципиальных схем групповых электрических щитов промышленных и Обзор лучших программ для черчения электрических схем Рейтинг , голоса февр г Программы для рисования электрических схем обзор популярных Формирование конструкторской документации однолинейной схемы , QElectroTech программа для составления , просмотра и печати Microsoft Visio Dip Trace схема XCircuit Чертим однолинейную схему обзор бесплатных программ Похожие мая г Пример однолинейной электрической схемы Программа позволяет корректно подобрать серию корпуса и его размер, исходя из Видео Автоматическая прорисовка однолинейной схемы Autelec ! YouTube сент г Как быстро начертить однолинейную эл схему! White Raven YouTube нояб г Конструктор однолинейных схем Описание работы Денис Рыженков YouTube мар г Все результаты Программа для рисования схем бесплатная, платная stroychikru Облегчить и ускорить черчение схем может программа для рисования схем Редактор электрических схем QElectroTech; Графический Компас Электрик; Программа DipTrace для рисования однолинейных схем и Бесплатные программы Редактор Программа DipTrace Программы для черчения электрических схем квартир и домов База знаний Софт для электриков Похожие Рейтинг , голосов апр г Обзор лучших программ для составления электрических схем же бесплатных ПО для составления однолинейных электросхем на компьютере Еще одна популярная программа для черчения электросхем и Программа для рисования схем электроснабжения ZwCAD Как нарисовать однолинейную схему электроснабжения,какими когда в программе для разработки электрических схем можно нажать пару кнопок, Программа для черчения однолинейных схем электротехнический форум forumruviewtopicphp?ft Похожие февр г Программа для черчения однолинейных схем нашел только обсуждение софта для выполнения электрических принципиальных схем С Hager работал тоже удобная штука для составления однолинеек, жаль Программа для Однолинейных Электрических Схем ДНД КОС ДНД Конструктор Однолинейных Схем удобный программный инструмент для автоматизированного составления однолинейных электрических схем Софт для составления схем электроустановок форум электриков и wwwelectrikorg Проектирование ПО по проектированию ЭУ Похожие окт г сообщений авторов Там же видеоуроки по черчению электрических схем Ищу программу для черчения схем типа таких чертит однолинейные схемы в DXF открываются в AutoCAD, делает спецификацию с партномерами Программа sPlan создание схем электрических скачать Программа sPlan инструмент для создания схем скачать бесплатно Программы для электриков краткий обзор наиболее популярных electrikinfoprogrammydlyaelektrikovkratkiyobzornaiboleepopulyarnyh Похожие Рассмотрим популярную программу для создания электрических схем sPlan токарного станка, инженер однолинейную схему электрической сети, Рисование электрических схем в программе Microsoft Word wwwsxemotehnikaruprogrammirisovanieelektricheskichschemvprogrammem Похожие Для рисования электрических схем существуют большое множество программ В этой статье я расскажу как с помощью широко известного текстового Однолинейная схема электроснабжения назначение, виды Коммуникации Электрика и освещение Рейтинг , голосов Однолинейная схема электроснабжения что это такое и её виды, DipTrace программа используется для составления электрических схем и Однолинейная схема электроснабжения рисование и создание wattruelektrosnabzhenieodnolinejnayaskhemaelektrosnabzheniya Однолинейная схема электроснабжения как нарисовать Расчетная А этот вид схемы составляется при строительстве нового объекта Эльф Данная программа отличный помощник для проектирования схем На сегодняшний день существует масса программ для рисования электрических схем QElectroTech программа для рисования электрических схем QElectroTech бесплатная программа для проектирования рисования электрических схем Позволяет создавать схемы , используя большой набор Картинки по запросу программа составления однолинейных электрических схем Другие картинки по запросу программа составления однолинейных электрических схем Жалоба отправлена Пожаловаться на картинки Благодарим за замечания Пожаловаться на другую картинку Пожаловаться на содержание картинки Отмена Пожаловаться Все результаты Список программ для создания электрических схем prorabkincomelectroprogrammydlyachercheniyaelektricheskihshem Перейти к разделу Примеры бесплатных программ для выполнения однолинейной Программа схема доступна для копирования с программа для создания однолинейных электрических схем didocrosbycomprogrammadliasozdaniiaodnolineinykhelektricheskikhskhems дек г программа для создания однолинейных электрических схем скачать бесплатно Yahoo Search Results Yahoo Web Search Sign in Mail программа для рисования электрических схем SoftFlyru wwwsoftflyrugrafikarisovanieqelectrotech Похожие В данной программе имеется множество различных элементов для начертания электрических схем , таких как элементы логических схем , Язык интерфейса Русский Программа для составления однолинейных схем beiperhypylhatenablogcomentry июн г Программа для составления однолинейных схем электроснабжения Программы для рисования электрических схем проводки Rusplan отличная программа для рисования схем рекомендуем radiobookaru Полезные программы для радиолюбителей Похожие Rusplan отличная программа для рисования схем рекомендуем Можно легко редактировать элементы библиотеки и создавать свои Скачать PDF программа для составления однолинейных электрических схем электросхем на компьютере Полностью бесплатная программа для черчения электрических схем на компьютере Составление однолинейных схем Программы для черчения электрических схем Сайт Паяльник cxemnet Программы Похожие Простая в работе программа для рисования наглядных электрических схем , заточенная под Arduinoпроекты Программа свободно распространяется и Программы для создания схем Форум Mastergrad wwwmastergradcom Электрика Программы для создания схем янв г сообщения авторов Какие есть программы для рисования электрических схем ? если могу еще поделитиься файлом однолинейной схемы в Экселе Ищу программу для создания визуальной схемы квартирного эл щита Программы Для Чертежей Однолинейных Электрических Схем мар г Данная программа для создания схем , хорошо работает с векторной графикой программам для подготовки однолинейных электрических схем Обзор лучших программ для составления электрических схем лучших программ для построения электрических схем Программы для радиолюбителя Рейтинг голосов Это программа для рисования схем в Windows, доступная для бесплатной однолинейных диаграмм;; создания блок схем ;; разработки технических Программа для черчения электрических схем для чего нужна Перейти к разделу Примеры платных программ для выполнения однолинейной Создание чертежей электрических схем sPlan Здесь перед ВИДЫ ЭЛЕКТРИЧЕСКИХ СХЕМ ПРИМЕНЯЕМЫХ В СТК conssystemsruvidylektricheskikhskhemprimenyaemykhvraspredelitelnykhsety Похожие Автоматизированное составление однолинейных схем , подсчет нагрузок, подбор Программа включает в себя достаточно обширную базу возможных Splan скачать бесплатно Splan Sibnet Софт Рейтинг , голоса Для рисования электрических схем программа удобна Опубликовал статьи и журналах ВАК с ее помощью Просто вырезал изображения с экрана из Однолинейные схемы электроснабжения Проектирование и февр г Составление однолинейных электрических схем силового оборудования, освещения в программе Visio и AutoCAD разработка схем Программы для рисования электрических схем проводки Электрофорум electroforumsuindexphp?topic Похожие февр г Возможно я что то не допонял в электрических однолинейных схем с я Черчение электрических схем в программе sPlan ОтветыMailRu посоветуйте программу для создания однолинейных Компьютеры, Связь Прочее компьютерное апр г скачивала sPlan виснет, QElectroTech не рабочая Программа составления однолинейных схем Автор Олег Андрушко lsrgnlconsultationprogrammasostavleniyaodnolineynihshemhtml Программа составления однолинейных схем различных параметров электрических систем, изображать электрические схемы , выбирать различное Программа схема для комплектации распределительных Программа схема разработана для выбора оборудования модульных спецификации и отрисовки однолинейной электрической схемы щита Программа для проектирования электропроводки в доме Электропроводка Рейтинг голосов мая г Программа для расчета электропроводки в доме бесплатные и коммерческие решения Графический редактор для составления схем проводки и рисования причем полноценная однолинейная схема электропроводки не Бесплатная программа для рисования электрических схем promise Программы для проектирования электрики и монтажных irinvestruproductspromisephp Похожие Программа для проектирования электрики promise представляет собой электрических схем , таблиц соединений, компоновку монтажных схем и полностью исключить ошибки при составлении перечней элементов к Наряду с расчетами, составляются однолинейные схемы щитового оборудования Проектирование электрических схем; расчет электрических wwwsapralfaruindexphp?fuseactionalfa_se Похожие Альфа Составление однолинейных схем , подсчет нагрузок, подбор оборудования, выполнить проект, начиная с однолинейной электрической схемы Программа включает в себя достаточно обширную базу возможных Нарисовать принципаильную схему в ворде просто! RUQRZCOM сент г Рисуем принципиальную схему в редакторе MS Word специальную программу рисования электрических схем ;; простота рисования Правила чтения электрических схем и чертежей Школа для electricalschoolinfomainpravilachtenijajelektricheskikhskhemhtml Похожие Правила чтения электрических схем и чертежей Основными техническими документами для электромонтера и электромонтажника являются чертежи и Однолинейная схема щита программа для отрисовки по ГОСТ ddecadruavtomaticheskoeproektirovanieprintsipialnykhskhemelektricheskikhsch Похожие янв г Рассмотрим алгоритм создания однолинейных принципиальных схем электрических щитов в программе DDECAD Visio для черчения электрических схем Похожие мая г Выбор программы для создания электрических схем электрическую схему , и какую программу использовать для черчения схем ? Автоматическое составление спецификация, для меня так же не является nanoCAD Электро САПР и графика автор К Мокин После проведения расчета программа автоматически равномерно Расчет электрических нагрузок в nanoCAD Электро осуществляется по трем Рис Однолинейная схема электрической сети Рис Результаты Добро пожаловать в финальную версию QElectroTech! QElectroTech это хорошая чертежная программа профессионального качества для которые охватывают наиболее часто используемые в электрических , Эти элементы могут быть выбраны, перетянуты мышью в редактор схем и Однолинейный Однолинейное представление проводников строго DOC программа расчета однолинейных схем низкого и Программы РЗА окт г DOC это программа предназначена для создания и расчета Создание однолинейных электрических схем на низкое и среднее Программное обеспечение LEGRAND wwwlegrandrusupportlibrarysoftware Похожие Программа XL Pro упрощает проектирование низковольтных комплектных перечня, необходимое для сборки шкафа;; с помощью однолинейной схемы сектора, составлением проектов электрической части помещения Как сделать однолинейную схему электроснабжения своими Электрика в квартире Монтаж Похожие Особенности составления однолинейной схемы электроснабжения, как составить ее своими Однолинейная схема электроснабжения своими руками В частности, программа AutoCAD вам поможет создать проект офиса, торгового Соединение электрических проводов в распределительной коробке Отзывы покупателей Чертежи и схемы в Visio черчения электрических схем Нормальная схема ЭС РУ схемы главных цепей Прекрасный комплект для создания чертежей и схем в Visio! ps Не нашел обозначение Реле напряжения для однолинейной схемы Данная программа Библиотека Visio Электроавтоматика ПРО очень облегчает программа для моделирования электронных схем с проверкой galerielereverberecomprogrammadliamodelirovaniiaelektronnykhskhemspro мар г программа для моделирования электронных схем с проверкой Spicy schematics Программа для черчения электрических схем какой выбрать Программа Для Составления Однолинейных Схем booksinstitute COLAN KVM ATEN Форум Электрика Однолинейная схема распред wwwcolanruforumnewviewphp?idthreadfromstep Похожие сент г Просят схему РАСПРЕДЕЛИТЕЛЬНОЙ СЕТИ, а не щита Есть ГОСТы ЕСКД по оформлению принципиальных электрических схем , Вместе с программа составления однолинейных электрических схем часто ищут программа для рисования электрических схем квартиры программа для рисования электрических схем по госту программа для создания электрических схем и проверки конструктор однолинейных схем днд конструктор однолинейных схем скачать бесплатно составление электрических схем в какой программе рисовать схемы программа для чтения электрических схем Документы Blogger Hangouts Keep Jamboard Подборки Другие сервисы

Информация о программах Академии САПР и ГИС по обучению и повышению квалификации специалистов. Биржа труда проектировщиков. Каталог организаций и предприятий. Чертежи, нормативная документация, литература, пособия, утилиты, программы для AutoCAD. Оказание услуг по сверке и составлению однолинейных электрических схем электрооборудования здания Арбитражного суда Свердловской области. Сведения о связи с позицией плана-графика. Знание ПУЭ, ПТЭЭП, современных схем электро снабжения зданий, диспетчеризации, КИПа. опыт проектирования внутреннего электроснабжения. …электро оборудования, организация ППР и текущего ремонта, проектирование внутреннего электроснабжения, составление схем электроснабжения, однолинейных электрических схем,… Промо-программы. Создание принципиальной схемы распределительной и питающей сетей; Составление силовых однолинейных схем; Создание однолинейных расчетных схем; Подведение итогов 13.00 ЗАВЕРШЕНИЕ РАБОТЫ КОНФЕРЕНЦИИ. Деловая программа научно технической конференции современные технологии строительства и ремонта трубопроводов. ФГОС и программы общего образования. Русский язык: избранные ресурсы. К составлению аналитических справок подключится также Федеральный институт педагогических измерений. …Первушин А. …. 187 Метод автоматической разметки предложения для этапа синтаксической сегментации, Манушкин Е.С. … 191 Метод формирования модели глагольного управления для русского языка, Кочеткова Н.А. … 199 Параллельный алгоритм составления…

програми для черчения с рускоязичним интерфейсом скачати

програми для черчения с рускоязичним интерфейсом

Программа для черчения микросхем на компьютере. Это узкоспециализированное ПО станет хорошим помощником всем пользователям, которые имеют дело с техникой. Взаимодействие с интерфейсом ExpressPCB довольно простое, несмотря на отсутствие русскоязычной локализации. Обобщенный ход работы состоит из следующих шагов: Выбор элементов микросхемы.  Бесплатная программа для черчения и создания трехмерных моделей реальных объектов. При этом их размер ничем не ограничен, все упирается только в вычислительную мощность компьютера. В процессе создания модели записывается каждый выполненный шаг, поэтому присутствует возможность просмотреть историю и вернуться на определенный этап.

Чертеж, САПР. Показывать программы: Сортировать по: С любой лицензией Бесплатная Условно-бесплатная Бесплатная (с рекламой) Демо версия Только данные Платная. Все ОС Windows 10 Windows 8.1 Windows 8 Windows 7 Vista WinXP Win98 WinNT 4.x WinME Win2000 Win2003 MS-DOS. Дате обновления Размеру файла Рейтингу скачивания.  Мы используем файлы cookies для того, чтобы предоставить вам больше возможностей при использовании нашего сайта.

Скачать программы для черчения – создание и редактирование чертежей, схем, планов, САПР. Бесплатные программы для черчения, пробные версии мощного программного обеспечения для профессионалов.  Программы для создания и редактирования чертежей, схем, планов, САПР. Последние обновления в категории Программы для черчения. AivsБТИ 1.5.200100. Shareware.

В данном разделе собраны все популярные программы для черчения на компьютере.   Каждая из программ для черчения на компьютере обладает полным набором функции для быстрого создания необходимого чертежа, оформления его и вывода на печать. Выбрать и скачать программы для черчения на компьютере вы можете с нашего сайта. nanoCAD 5.1. Программа на русском языке, предназначенная для профессионального проектирования и создания чертежей. Размер: 372,0 Мб.

Черчение — важный и обязательный предмет для будущего технического специалиста. В настоящее время существует множество различных чертёжных программ, среди которых можно выделить профессиональные (платные) и упрощённые (бесплатные). Для вас мы приготовили обзор самых популярных и многофункциональных из них.  Она имеет множество достоинств, среди которых, простой интерфейс, многофункциональность и хорошие справочные данные. Всё это позволяет создавать качественные и оригинальные проекты. Также 3D чертёж, КОМПАС-3D позволяет перенести в 2D и наоборот.

Обзор программ для чертежей. Конструкторские чертежные программы можно условно разделить на 2 класса – профессиональные (платные) и упрощенные (как правило бесплатные). Кроме того программы для создания чертежей могут подразделяться в зависимости от вида деятельности: САПР, 3д-моделирование, архитектурные, дизайн интерьеры, стальные конструкции, расчтеные и т.п. Приведем основные: Профессиональные конструкторские программы (САПР). Autocad – одна из самых популярных программ двух и трехмерного проектирования и черчения. SolidWorks – мощный комплекс трехмерного проектирования, часто используется

Интерфейс программы прост и интуитивно понятен любому пользователю. Установленная в Windows, она обеспечивает высокую скорость работы и избавляет пользователя от монотонной работы благодаря интерфейсу пользователя и применению интеллектуальных параметрических обьектов. Пользователю предоставляется широкий выбор палитры, с помощью которой возможно применение нестандартных цветовых линий и штриховки. Скачать KiCad. 26-07-2020, 12:40. KiCad – бесплатный редактор, предназначенный для создания электрических схем, разработки печатных плат, осуществления сквозного проектирования (в автоматическом реж

Какие легкие компьютерные программы для строительного черчения схем, геометрических чертежей для проектов на русском лучше выбрать узнайте в данной статье на zwsoft. ru.  Как называются лучшие программы для черчения на компьютере? Сейчас выясним. Но перед этим обозначим пункты, по которым будем их сравнивать. ZWCAD 2020 Professional (годовая лицензия). 3D-моделирование и визуализация, поддержка внешних приложений, интерфейсов .Net/VBA/ZRX и все возможности стандартной версии. Срок действия лицензии – 1год. 15 000 ₽.

Программы для черчения, создание проектов и документации. Архитекторы и дизайнеры смогут проектировать дома и интерьеры, электронные схемы и двигатели.  Программы для черчения, помогут создавать свои проекты максимально эффективно и абсолютно бесплатно. Архитекторы и дизайнеры смогут найти решения для проектирования домов и интерьеров, электронных схем и двигателей, и многого другого. Софт в данной рубрике обеспечит полуавтоматическое выполнение проектов и сопутствующей документации. Autodesk DWG TrueView – просмотр и печать файлов DWG и

Бесплатные и профессиональные платные программы для черчения домов и коттеджей на компьютере. Какой популярный софт для создания чертежей есть на русском языке.  Она разработана российскими специалистами, поэтому проблем с русским интерфейсом нет, а также все хорошо с работой по ГОСТам и СНИП. Она предназначена для рисования различных схем и проектов, редактирования уже построенных чертежей.  Интерфейс программы доступен в русскоязычной версии. Чтобы достичь желаемого результата и получить качественный чертеж или схему, необходимо обладать базовыми навыками работы с чертежами, их построения и чтения.

В этой статье мы проведем обзор 3 популярных программ для черчения на компьютере: рассмотрим плюсы и минусы каждой. а так же сферу применения. В эпоху развития цифровых технологий, ручное черчение стало анахронизмом. Уже давно популярна практика выполнения проектов на персональном компьютере с последующей распечаткой на соответствующем формате. А с созданием 3D–принтеров появилась возможность притворять к жизни объемные модели. Главная особенность подобного вида черчения – доступность. Выполнять работы могут как новички, постигающие азы, так и матерые профессионалы, зарабатывающие на жизнь про

Скачать бесплатные системы автоматизированного проектирования и черчения для компьютера под Windows.  Autodesk Design Review – бесплатная компьютерная программа, используемая для создания, просмотра и печати файлов DWF, DWG, DXF, PDF и растровых изображений (BMP, JPG, GIF, PCX,… Скачать. 2D и 3D, Графика и дизайн, Чертёж и САПР.

Если Вам нужна простая программа для черчения, то Вы попали по адресу. Мы составили список из пяти самых простых образцов ПО, которыми пользуются люди, занимающиеся 2D и 3D моделированием. Выбирали мы их по одному простому критерию – простоте использования.  Версий с русскоязычным интерфейсом пока что нет, выбирать надо будет исходя из того, нужна ли однозначно программа для черчения на русском (если критичны познания даже английского языка). 3. Специализированная на построение чертежей, связанных с машиностроением, и имеет все необходимые именно для этой области инструменты.

Программы для черчения на компьютере упрощают процесс создания чертежей. Чертеж в подобных приложениях рисуется гораздо быстрее, чем на реальном листе бумаге, а в случае совершения ошибки ее можно легко исправить в пару кликов. Поэтому программы для черчения давно стали стандартом в этой области. Но среди программных решений в области черчения также есть разница между различными приложениями.  Если вы только начинаете работать с черчением на компьютере, то обратите внимание на программу A9CAD. Это очень простая и бесплатная программа для черчения. Простой интерфейс позволит вам без труда сделать первые шаги в черчении и создать свои первые чертежи.

Программы для черчения. В 21 веке люди практически перестали делать чертежи руками. В них можно ошибиться, допустить серьёзную погрешность из-за невнимательности, а масштабировать такие чертежи невозможно. Именно поэтому всё чаще для работы и обучения используют именно цифровые CAD решения. Они гарантируют качество графических изображений, их масштабируемость и сохранность. Бесплатные программы для черчения.  Российские пользователи ценят её за удобный и локализованный интерфейс, поддержку ЕСКД и ГОСТов. Это очень важно, ведь соответствие техническим требованиям — основное условие, ставящееся перед любой программой для черчения.

Самые простые программы на русском языке для черчения электросхем и моделирования проектов электропроводки помещений., Самые простые программы на русском языке для черчения электросхем и моделирования.  Существует не так много русскоязычных, удобных в использовании и к тому же бесплатных ПО для составления однолинейных электросхем на компьютере. Итак, мы создали небольшой рейтинг, чтобы Вам стало известно, какие программы лучше для рисования схем электроснабжения домов и квартир: Microsoft Visio.

Лучшие программы для черчения. Программы для черчения на компьютере упрощают процесс создания чертежей. Чертеж в подобных приложениях рисуется гораздо быстрее, чем на реальном листе бумаге,а в случае совершения ошибки ее можно легко исправить в пару кликов. Печать. Поэтому программы для черчения давно стали стандартом в этой области. Но среди программных решений в области черчения также есть разница между различными приложениями. Многие из них обладают большим количеством функций, подходящих профессионалам. Другие программы могут похвастаться простым внешним видом, который отлично подойдет нов

Для начала рассмотрим главные возможности программы для черчения, чтобы вы могли определиться с выбором подходящего варианта. Основные функции перечислены в представленном списке: создание и редактирование 2D/3D чертежей  Все меню и названия инструментов переведены на русский язык, поэтому любой пользователь, знакомый с черчением, разберется в основах программы. В главном окне появится 3 вкладки: Документы.

2. Программа для черчения на компьютере имеет сравнительно легкий и понятный интерфейс, со всеми особенностями можно легко разобраться самостоятельно при помощи справочных материалов. 3. Программы “Компас” ориентированы на конструирование в машиностроении и на проектирование в строительстве.   Версий с русскоязычным интерфейсом пока что нет, выбирать надо будет исходя из того, нужна ли однозначно программа для черчения на русском (если критичны познания даже английского языка). 3. Специализированная на построение чертежей, связанных с машиностроением, и имеет все необходимые именно для этой области инструменты.

Программа простая русскоязычная чертежная. Лучшие программы для черчения. В этой статье мы проведем обзор 3 популярных программ для черчения на компьютере: рассмотрим плюсы и минусы каждой. а так же сферу применения. В эпоху развития цифровых технологий, ручное черчение стало анахронизмом. Уже давно популярна практика выполнения проектов на персональном компьютере с последующей распечаткой на соответствующем формате.

Интерфейс в программе достаточно прост и интуитивно понятен. Единственный недостаток — нет поддержки русского языка… 6) FreeCAD.  Программы для черчения на компьютере упрощают процесс создания чертежей. Чертеж в подобных приложениях рисуется гораздо быстрее, чем на реальном листе бумаге, а в случае совершения ошибки ее можно легко исправить в пару кликов. Поэтому программы для черчения давно стали стандартом в этой области. В статье представлены лучшие программы для черчения, существующие на сегодняшний день.  Если вы только начинаете работать с черчением на компьютере, то обратите внимание на программу A9CAD. Это очень простая и бесплатная программа для черчения.

Новая версия программы, для создания и черчения электронных и электрических схем с библиотекой. Одной из лучших программ для создания чертежей электронных схем. Имеется библиотека ГОСТ’овских элементов. В комплекте дополнительные авторские библиотеки.  Программа sPlan – простой и удобный инструмент для черчения электронных и электрических схем. Интерфейс полностью на русском языке. Добавил: Alex625. Загружено сегодня: 0 · Загружено всего: 26394.

4. Бесплатные программы для черчения. Студенты инженерных специальностей во время учебы выполняют графические задания в электронном виде с помощью специальных CAD-программ.  Каждая программа для чертежей имеет свои особенности, с помощью которых пользователь может увеличить работоспособность. Предпочтение отдается софту, устанавливаемому на ПК, так как он имеет большее количество функций. Лидерами являются КОМПАС от российской компании Аскон и AutoCAD от Autodesk.  Есть русскоязычная версия. Можно приобрести месячную, годовую или постоянную лицензию. VariCAD в большей степени предназначена для машиностроительных чертежей.

Для черчения DraftSight предоставляет весь вышеупомянутый «джентельменский набор». Кроме этого, DraftSight умеет: Экспорт чертежей в PDF и SVG.  Цветовая гамма пользовательского интерфейса на любителя, впрочем, тёмная тема сейчас в тренде. Развитие программы остановилось еще в 2012 году и никаких новостей не слышно, а платные версии даже название сменили на TurboCAD. Для работы в бесплатной версии нужно получить серийный номер и код активации.

Программа полностью на русском языке. Распространение: Freeware (бесплатная с ограничениями) и Shareware (платная). Подробнее. Kicad. САПР сквозного проектирования, позволяющая создавать профессиональные электрические схемы и разрабатывать для них печатные платы. Редактор eeschema позволяет создавать многолистовые иерархические схемы и проводить их проверку на соответствие электрическим правилам. На русском языке.  Программа позиционируется как рядовое приложение для черчения и редактирования двумерных иерархических электронных схем самой разной степени сложности. Редактор электрических схем рассчитан на совместную работу со средой проектирования FreePCB. Бесплатная.

Система автоматизированного проектирования и черчения. Наиболее популярная программа для этих целей. Autodesk разрабатывает AutoCAD с 1982 года.  FreeCAD – бесплатная мультиплатформенная CAD программа для создания 3D моделей. FreeCAD может быть использована в техническом проектировании, конструировании изделий, а также в иных областях, связанных с осуществлением инженерно-технических работ. Программа хорошо подходит для создания моделей для 3D принтера, так как поддерживает STL формат.  Программный пакет имеет дружелюбный и интуитивно понятный интерфейс (в том числе и на русском языке). Среди функций есть всё необходимое, что должна иметь серьёзная CAD-система.

Это программа от корпорации Google с интерфейсом на русском языке. В ней есть все самое необходимое чтобы начать работу в мире моделирования – стандартный набор инструментов, простейший интерфейс (никаких скрытых меню и непонятных функций), а также подробная справка. Что касается последнего, то помимо обычного для любой хорошей программы списка типичных вопросов и ответов, в SketchUp есть также набор видеоуроков.  Не зря пользователи сравнивают данную программу для черчения с AutoCAD, ведь они практически схожи, стоит хотя бы обратить внимание на интерфейс A9CAD.

Программа КОМПАС. Возможности программы для черчения широкие – она может работать со всеми форматами изображений. Наличие графического, визуального и текстового редактора. Программа для рисования может использоваться дома или в проектном бюро, с ее помощью легко реализуются и визуализируются строительные проекты. Обновление возможностей и исправление ошибок в программе происходит автоматически.   Пейнт обладает привычным русскоязычным интерфейсом, им эффективно редактируется векторная графика. Pixbuilder Studio отличается высокими показателями работоспособности, остальные утилиты из вышеприведенной подборки, демонстрируют более низкую скорость запуска и открытия изображений.

Программа простая русскоязычная чертежная. Лучшие программы для черчения. В этой статье мы проведем обзор 3 популярных программ для черчения на компьютере: рассмотрим плюсы и минусы каждой. а так же сферу применения. В эпоху развития цифровых технологий, ручное черчение стало анахронизмом. Уже давно популярна практика выполнения проектов на персональном компьютере с последующей распечаткой на соответствующем формате.

Главная » Программы для проектирования мебели. Чертежная программа для чайников простая на русском. Сапр, чертеж, моделирование. 21.02.2018Рубрика: Программы для проектирования мебели. Любое проектирование начинается с создания чертежа.  В области автоматизированного проектирования появились программы для черчения на компьютере , которые обеспечивают построение качественных чертежей различной сложности. Они требуют довольно внушительных знаний, но теперь, для построения любого чертежа, не обязательно посещать конструкторские отделы, любой человек, без особых усилий и даже в домашних условиях может без проблем выполнять данную работу.

Система автоматизированного проектирования и черчения. Наиболее популярная программа для этих целей. Autodesk разрабатывает AutoCAD с 1982 года.  FreeCAD – бесплатная мультиплатформенная CAD программа для создания 3D моделей. FreeCAD может быть использована в техническом проектировании, конструировании изделий, а также в иных областях, связанных с осуществлением инженерно-технических работ. Программа хорошо подходит для создания моделей для 3D принтера, так как поддерживает STL формат.  Программный пакет имеет дружелюбный и интуитивно понятный интерфейс (в том числе и на русском языке). Среди функций есть всё необходимое, что должна иметь серьёзная CAD-система.

Интерфейс программы очень прост, и с ним справятся даже те инженеры и архитекторы, которые до этого не работали с CAD системами. Также, стоит отметить набор типичных для черчения инструментов. Они полностью соответствуют реальным аналогам.  Если Вам придется скачать программу для черчения чертежей, помните, что две описанные программы – среди лидеров запросов специального ПО для черчения. Специфические задачи Как сделать чертеж на компьютере, если нужно построить чертеж яхты? Здесь однозначно нужно будет искать специальные проекты, которые пригодятся для такой работы.

Программы для черчения на компьютере. На сегодня мы приготовили для вас статью с обзором самых популярных и многофункциональных программ для черчения.  Не зря пользователи сравнивают данную программу для черчения с AutoCAD, ведь они практически схожи, стоит хотя бы обратить внимание на интерфейс A9CAD. В программе можно создавать двухмерные чертежи разной сложности, проставлять размеры на чертежах, имеется поддержка слоев.  Вы сможете насладиться доступным русскоязычным интерфейсом и большим количеством обучающих видеоуроков и материалов в интернете. Работа с Tux Paint, направлена на качественное обучение неопытных пользователей.

Программа для черчения принципиальных электрических схем поможет быстро построить практически любую схему без особых усилий. Для этого она оснащена множеством функций, уже встроенных в программу. Например, можно поворачивать текстовые объекты, редактировать толщину линий и даже добавлять свои элементы. Единственным недостатком этой утилиты является отсутствие активации многих представленных функций при использовании незарегистрированной версии программы.  Минусом этой программы является отсутствие русскоязычного интерфейса, только немецкий и английский. Плюсы sPlan: функция превью

Версий с русскоязычным интерфейсом пока что нет, выбирать надо будет исходя из того, нужна ли однозначно программа для черчения на русском (если критичны познания даже английского языка). 3. Специализированная на построение чертежей, связанных с машиностроением, и имеет все необходимые именно для этой области инструменты.   2. Анонсирована как простая программа для черчения, очень лёгкая в использовании и имеющая простой интерфейс. 4. Операции только в 2D.

CorelCAD 2014 – программа, которая включает в себя все стандартные для САПР функции редактирования и создания 3D-, 2D-проектов. С помощью данного инструмента комфортно работать с файлами фор.  Скачать CorelCad 2014 можно как в русскоязычной, так и в англоязычной версии. Понятный интерфейс, удобство пользования, высокая скорость работы, наличие всех необходимых инструментов линейки САПР – все это CorelCAD версии 2014 года!

B. Содержание: Черчение. Описание. СКАЧАТЬ. Возможности. Установка. Интерфейс. Черчение. Редактирование. Работа со слоями. Сохранение. Выводы. Видео. Похожие программы. Комментарии. Черчение — важный предмет для всех, кто учится на технического специалиста или уже работает в этой сфере. И здесь просто необходимо использовать правильно подобранные программы. Что-то элементарное можно набросать и в обычном графическом редакторе, но для серьёзных проектов нужны мощные системы автоматизированного проектирования. Но порой бывает, что нужно по-быстрому набросать несложный чертёжик, а установленной С

Программа для черчения на компьютере? Вычислительная техника проникла во все сферы человеческой деятельности. Не стало исключением и инженерное дело.  Версий с русскоязычным интерфейсом пока что нет, выбирать надо будет исходя из того, нужна ли однозначно программа для черчения на русском (если критичны познания даже английского языка). 3. Специализированная на построение чертежей, связанных с машиностроением, и имеет все необходимые именно для этой области инструменты.

Бесплатно скачать Dia Diagram Editor на русском языке для Windows. Dia Diagram Editor – бесплатный и понятный редактор для рисования всевозможных диаграмм, структур UML, блок-схем описывающих алгоритмы программ, связей в базах данных и даже схем размещения устройств в локальной сети.  Dia Diagram Editor – бесплатный и понятный редактор для рисования всевозможных диаграмм, структур UML, блок-схем описывающих алгоритмы программ, связей в базах данных и даже схем размещения устройств в локальной сети. Разработчики прямо заявляют, что при создании Dia вдохновлялись и старались превзойти другой коммерческий продукт – Windows Visio, выпущенный компанией MicroSoft.

Методические указания “Рисование электрических схем”

Департамент образования Ивановской области

Областное государственное бюджетное

профессиональное образовательное учреждение

«Ивановский колледж легкой промышленности»

Рисование электрических схем

МЕТОДИЧЕСКИЕ УКАЗАНИЯ

к выполнению практической работы

по дисциплине ОУД.О7 ИНФОРМАТИКА

Иваново, 2017

Составитель C.В.Зотова

Редактор Е.А.Тюпкина

Рекомендованы для проведения учебных занятий по дисциплине ОУД. 07 Информатика (раздел «Информация и информационные процессы»). В практической работе предложены варианты заданий различного уровня сложности.

Предназначены для профессиональных образовательных организаций, реализующих основную профессиональную образовательную программу СПО на базе основного общего образования с одновременным получением среднего общего образования по специальностям 13.01.10 Электромонтер по ремонту и обслуживанию электрооборудования (по отраслям), 15.01.21 Электромонтер охранно-пожарной сигнализации и по специальности среднего профессионального образования 15.10.31 Монтаж и техническая эксплуатация промышленного оборудования.

Утверждены предметной (цикловой) комиссией

математического и естественнонаучного цикла

Содержание

sPlan 4.0

5

2.2

Редактор электрических схем QElectroTech

6

2. 3

Графический редактор MS Visio

6

2.4

Программа «1-2-3 schema»

7

2.5

Компас Электрик

7

2.6

Возможности MS Word

3.

Практическое занятие. Выполнение чертежей электрических схем с использованием Microsoft Word.

3.1

Теоретическая часть

3.2

Практическая часть

Введение

В программу дисциплины ОУД.07 Информатика включено содержание, направленное на формирование у студентов компетенций, необходимых для качественного освоения основной профессиональной образовательной программы СПО на базе основного общего образования с получением среднего общего образования – программы подготовки квалифицированных рабочих, служащих, программы подготовки специалистов среднего звена.

В методической разработке

Освоение содержания учебной дисциплины «Информатика», обеспечивает достижение студентами следующих предметных результатов: использовать прикладные компьютерные программы по профилю подготовки. Для осуществления этой задачи разработаны данные методические указания, в которых приведен обзор и анализ программных средств для рисования электрических схем.

В качестве инструмента для проведения практического занятия предложен простой способ рисования электрических схем с помощью доступного программного обеспечения – текстового редактора MS Word.

В теоретической части практического занятия дается описание панели инструментов для рисования электрических схем.

В первом задании практической части представлена подробная инструкция по установке необходимого шаблона Normal.dot.

В следующих заданиях практической части предлагается выполнить три задания разной степени сложности.

Обзор и анализ программ для рисования электрических схем

Мы все больше пользуемся компьютером и виртуальными инструментами. Вот уже и чертить на бумаге схемы не всегда хочется — долго, не всегда красиво и исправлять сложно. Кроме того, программа для рисования схем может выдать перечень необходимых элементов, смоделировать печатную плату, а некоторые могут даже просчитать результаты ее работы. В сети имеется немало неплохих бесплатных программ для рисования электрических схем. Профессионалам их функционала может быть недостаточно, но для создания схемы электроснабжения дома или квартиры, их функций и операций хватит с головой. Не все они в равной мере удобны, есть сложные в освоении,  но можно найти несколько бесплатных программ для рисования электросхем которыми сможет пользоваться любой, настолько в них простой и понятный интерфейс.

Самый простой вариант — использовать штатную программу Windows Paint, которая есть практически на любом компьютере. Но в этом случае вам придется все элементы прорисовывать самостоятельно. Специальная программа для рисования схем позволяет вставлять готовые элементы на нужные места, а потом соединять их при помощи линий связи.

Программа sPlan 4.0

Русифицированная компактная немецкая программа для быстрого рисования (черчения) электрических схем с использованием готовых изображений радиоэлементов. Содержит библиотеку готовых условно-графических изображений радиоэлементов и символов, а также набор рамок и штампов чертёжных форматов А4, А3, А2, А1 и бланки перечней элементов, соответствующих русским ГОСТам и употребляемых при черчении электрических и функциональных схем. Библиотеку можно редактировать и пополнять. Программа не требует инсталляции, просто распакуйте архивный файл и приступайте к работе.

Редактор электрических схем QElectroTech

Программа для рисования схем QElectroTech на русском языке, причем русифицирована она полностью — меню, пояснения. Удобный и понятный интерфейс — иерархическое меню с возможными элементами и операциями в левой части экрана и несколько вкладок вверху. Есть также кнопки быстрого доступа для выполнения стандартных операций — сохранения, вывода на печать и т.п. Интерфейс программы довольно прост и напоминает окно стандартного графического редактора.

В программе имеется обширный перечень готовых элементов, есть возможность рисовать геометрические фигуры, вставлять текст, вносить изменения на определенном участке, изменять в каком-то отдельно взятом фрагменте направление, добавлять строки и столбцы. В общем, довольно удобна программа при помощи которой легко нарисовать схему электроснабжения, проставить наименование элементов и номиналы. Результат можно сохранить в нескольких форматах: JPG, PNG, BMP, SVG, импортировать данные (открыть в данной программе) можно в форматах QET и XML, экспортировать — в формате QET.

Графический редактор MS Visio

Данный продукт позволяет начертить схему в масштабе, что удобно для расчета количества необходимых проводов. Большая библиотека трафаретов с условными обозначениями, различных составляющих схемы, делает работу похожей на сборку конструктора: необходимо найти нужный элемент и поставить его на место. Работа с фигурами максимально проста, поскольку разработчик грамотно упорядочил их по группам и категориям. Это позволяет значительно ускорить процесс моделирования.

К положительным моментам можно отнести наличие в Интернете видеоуроков по работе с этой программой для рисования схем.

Программа «1-2-3 schema» для комплектации электрощитов до 125А

Полностью бесплатная программа для черчения электрических схем на компьютере. С официального сайта можно скачать ее на русском языке и полной версией. Помимо моделирования проектов электроснабжения квартир, домов и других видов помещений, в данном программном пакете можно составить схему сборки распределительного щита, в которой сразу же будут представлены наиболее подходящие номиналы автоматов и релейной защиты. Приятным дополнением в данном ПО является база данных с наклейками, которые можно распечатать и расклеить в собственном распределительном щитке для графического обозначения всех элементов цепи по госту.

Возможности MS Word

Тем, кто уже умеет работать в текстовом редакторе Microsoft Word будет совсем не трудно нарисовать свою принципиальную электрическую схему. Здесь специально применяется термин «рисование электрических схем» вместо «черчение электрических схем» так как черчение подразумевает строгое выполнение чертежа схемы согласно ГОСТу, что в описываемом методе рисования электрических схем будет не всегда удобно.

Рисование электрических схем с помощью программы Microsoft Word производится с помощью набора заранее изготовленных рисунков электрорадиоэлементов, подключаемых к шаблону документа. Для этого необходимо выбрать нужный элемент из библиотеки, кликнуть на него, после чего он появиться в нашем документе. Останется расположить нужные элементы на рабочем листе, добавить провода и соединить места соединения схемы и наша схема готова! Не забываете пользоваться стандартными инструментами программы: линии, точки, круги и прочее что уже предусмотрено было самой программой Word.

Достоинства и недостатки использования программы Microsoft Word для рисования электрических принципиальных схем

Достоинства:
– нет необходимости устанавливать специальные программы;
– простота создания несложных электрических схем; 
– бесплатное распространение описанного шаблона;
– возможность сохранения схемы в форматах pdf, html.
Недостатки:
– сложность создания электрических схем по ГОСТу;
– при открытии файла со схемой в других версиях Word возможно нарушения форматирования документа;
– небольшой набор компонентов для рисования электрических схем.


Вывод: данный метод рисования электрических схем хорошо подойдет при оформлении несложных схем. Например, при выполнении курсовой или дипломной работы можно быстро нарисовать часть схемы, какой-то каскад или узел сложной схемы.

Практическое занятие. Выполнение чертежей электрических схем с использованием Microsoft Word.

Цель: Освоить правила выполнения чертежей с помощью MS Word.

Материальное обеспечение: ПК; инструкция к работе;

Microsoft Word 2010

Ход работы

І. Теоретическая часть.

Рисование электрических схем с помощью программы Microsoft Word производится с помощью набора заранее изготовленных рисунков электрорадиоэлементов, подключаемых к шаблону документа.

Описание панели инструментов для рисования

электрических схем

Рассмотрим подробнее панель для рисования электрических схем (рисунок 1).

Рисунок 1. Панель для рисования электрических схем.

На ней расположены:
1. Панель форматирования текста, абзаца, вставки специальных объектов и меню вызова утилит.
2. Стандартная панель инструментов с некоторыми дополнительными функциями.
3. Панель инструментов Схема с набором библиотек электрорадиоэлементов и вставки стандартных объектов некоторых фигур.

Выпадающее меню Схема полностью повторяет панель Схема, которая включается нажатием на пиктограмму в виде обозначения транзистора.
Выпадающее меню Шаблон позволяет вставить на лист готовые шаблоны различных рамок, выполненных согласно ГОСТа (рисунок 2).

Рисунок 2. Меню Шаблоны

Инструменты выпадающего меню Утилиты предназначены для печати документа в виде книги.

С помощью инструментов выпадающего меню Язык выполняется различные функции, связанные с языком документа.

Из особенностей стандартной панели инструментов следует отметить наличие кнопок:
– вызов редактора формул; 
– вставка символов;
– отображения панели Схема.

Теперь перейдем к рассмотрению панели инструментов Схема (рисунок 3).

Рисунок 3. Панель Схема.

На панели имеются следующие блоки:
1. Кнопка вызова окна привязки объектов к сетке.
2. Группа инструментов для форматирования объекта.
3. Группа инструментов вставки стандартных объектов.
4. Группа инструментов вставки объектов из библиотеки элементов.

Библиотека инструментов для рисования электрических схем состоит из наборов основных электрорадиоэлементов и представлена на рисунке 4.

Рисунок 4. Библиотека инструментов для рисования электрических схем.

II. Практическая часть

Задание 1.

1. Скачайте в Интернете шаблон шаблон Normal.dot и сохраните его к себе в папку.

2. Откройте MS Word, зайдите в меню Файл – Открыть, перед нами появляется диалоговое окно, изображенное на рисунке 5.

Рисунок 5. Диалоговое окно открытия документа.

Далее делаем по пунктам, отмеченным на рисунке: 
1. В выпадающем списке тип документа ставим – Все шаблоны Word.
2. В окне проводника указываем путь до скачанного файла Normal.dot.
3. Выбираем файл Normal.dot.
4. Нажимаем кнопку Открыть.
Переходим в пункт Надстройки главного меню, где появляется дополнительная панель инструментов шаблона Normal.dot (рисунок 1.)

Задание 2. Создание электрических принципиальных схем.

Для рисования электрической схемы необходимо выбрать необходимый элемент в библиотеке, нажать на него и он тут же появиться в документе. После этого останется внесенные таким образом элементы расположить как вам необходимо на листе и соединить линиями места соединения схемы.

а) создать документ «Схема электрической цепи» по образцу, формат листа А4, ориентация альбомная

б) создать документ «Схема электрической цепи» по образцу, формат листа А4, ориентация альбомная

в) создать документ «Схема электрической цепи» по образцу, формат листа А4, ориентация альбомная

Программа для моделирования схем электроники на русском. Qucs – простой и бесплатный симулятор электронных схем

Программа для электрических схем — это инструмент, используемый инженерами, для создания электронных схем с целью расчета и тестирования изделий на этапах проектирования, производства, а также эксплуатации. Точное отображение параметров производится при помощи масштаба. Каждый элемент имеет свое обозначение в виде символов, соответствующих ГОСТу.

Программа для электрических схем: зачем мне это нужно?

При помощи программы для электрических схем можно строить точные чертежи, а затем сохранять их в электронном виде или распечатывать.

ВАЖНО! Почти во всех программах для рисования схем есть готовые элементы в библиотеке, потому вручную их можно не чертить.

Такие программы бывают платными и бесплатными. Первые характеризуются большой функциональностью, их возможности значительно шире. Существуют даже целые автоматизированные системы проектирования САПР, которые успешно используются инженерами во всем мире. С применением программ для черчения схем работа не только полностью автоматизированная, а и предельно точная.

Бесплатные программы уступают по функциональным возможностям платному софту, однако с их помощью можно реализовать проекты начальной и средней сложности.

Программное обеспечение позволяет упростить работу и сделать ее более эффективной. Мы подготовили перечень популярных программ для создания схем, используемых специалистами во всем мире. Но для начала давайте разберемся, что собой представляют схемы и каких видов они бывают.

Программы: для каких схем предназначены?

Схема представляет собой конструкторский документ графического типа. На нем размещены в виде условных обозначений составляющие компоненты устройства и связи между ними.

Схемы являются частью комплекта конструкторской документации. В них содержатся данные, необходимые для проектирования, производства, сборки, регулирования, использования прибора.

Когда нужны схемы?

  1. Процесс проектирования. Они позволяют определить структуру разрабатываемого изделия.
  2. Процесс производства. Дают возможность продемонстрировать конструкцию. На их базе разрабатывается технологический процесс, способ монтажа и контроля.
  3. Процесс эксплуатации. При помощи схем можно определить причину поломки, правильный ремонт и техническое обслуживание.

Виды схем по ГОСТу:

  • кинематические;
  • газовые;
  • энергетические;
  • пневматические;
  • гидравлические;
  • электрические;
  • комбинированные;
  • оптические;
  • деления;
  • вакуумные.

В какой программе лучше работать?

Существует огромное количество платных и бесплатных программ для разработки электрических чертежей. Функционал у всех одинаковый, за исключением расширенных возможностей у платных.

Visio

QElectro Tech

sPlan

Visio

Плюсы QElectro Tech

  1. экспорт в формате png, jpg, bmp или svg;
  2. проверка работоспособности электрических цепей;
  3. легко создавать схемы электропроводки, благодаря наличию обширной библиотеки;полностью на русском языке.

Минусы QElectro Tech

  1. функционал ограниченный;
  2. создание схемы сети начальной и средней сложности.

Простой интерфейс. Коллекция фигур для сборки электрических схем располагается слева в главном окне. В правой стороне находится рабочая область.

  1. Создать новый документ.
  2. Перетащить при помощи мышки в рабочую область необходимое количество элементов для создания и симуляции желаемого результата.
  3. Соединить детали между собой. Соединения автоматически преобразуются в горизонтальные и вертикальные линии.
  4. Сохранить файл с расширением qet.

Есть функция постройки собственных элементов и сохранения в библиотеке. Фигуры можно использовать в других проектах. Софт на русском языке. Программа подходит для Linux и Windows.

sPlan

Программа для построения электронных и электрических схем, рисования плат. При переносе элементов из библиотеки их можно привязывать к сетке координат. Софт простой, но позволяет создавать чертежи и рисунки разной сложности.


Фото 3 – Процесс составления схемы в sPlan

Задача sPlan заключается в проектировании и разработке электронных принципиальных схем. Для упрощения работы разработчик предусмотрел обширную библиотеку с геометрическими заготовками обозначений электронных элементов. Есть функция создания элементов и сохранения их в библиотеке.

Этапы работы:

  1. Создать новый документ.
  2. Из библиотеки элементов перетащить необходимые. Фигуры можно группировать, поворачивать, копировать, вырезать, вставлять и удалять.
  3. Сохранить.

В данной статье будет представлено 20 лучших программ для проектирования электронных схем и печатных плат, включая бесплатные, коммерческие и условно бесплатные программы.

Изучение дизайна макетов или электронных диаграмм не сложно, если вы выберете правильный инструмент дизайна. Для создания списка был использован ряд критериев, таких как:

  • качество программного обеспечения;
  • удобство для пользователя;
  • сложность среды проектирования.

Бесплатное программное обеспечение для рисования электронных схем:

Ниже будет представлен список и краткое описание бесплатных программ для проектирования электронных схем.

LTspice

Это программное обеспечение для моделирования от линейных технологий до разработки электронных схем, моделирования SPICE, диаграмм сигналов и многих других функций:

  • многоязычный графический интерфейс MDI для открытия и редактирования нескольких файлов в сеансе;
  • встроенный редактор схем с базой данных 2 тыс. электронных компонентов;
  • симулятор аналоговых и смешанных схем с режимом импорта файлов SPICE;
  • постпроцессор для генерации графических кривых результатов анализа и отчетов;
  • возможность персонализировать настройки режима отображения и сочетания клавиш;
  • удобные функции масштабирования окна просмотра, печати и копирования в буфер обмена;
  • интегрированная база данных схем выборки LTSpice .ASC.

Узнать больше и скачать LTspice вы можете на нашем .

«Компас-электрик»

Замечательная графическая российская программа, которая является разновидностью программы «Компас». Используется в области электрики для создания схем электрооборудования различных механизмов. Программа имеет обширные возможности. Посредством программы «Компас-электрик» возможно начертить любую электрическую схему.

Программа «Компас-электрик» имеет три версии, различные по своему функционалу: экспресс версия, стандартная версия, профессиональная версия. Основными компонентами данной программы являются:

  • База данных, которая является фундаментом для проектирования документации;
  • Редактор схем и отчетов, в котором происходит сам процесс создания и выпуска готовой документации проектов.

DipTrace

Это программа для проектирования профессиональных печатных плат. Вполне интуитивно понятный интерфейс, огромная функциональность. Dip Trace поддерживает несколько режимов работы. В каждый пакет DipTrace входят следующие программы:

  • редактор схем;
  • программа проектирования контуров — компоновка печатной платы;
  • редактор компонентов;
  • редактор корпуса;
  • автотрассировщик;
  • 3D-визуализация;
  • функция импорта библиотек и проектов из других программ EDA.

Скачать и получить более подробную информацию с обучающей книгой вы можете на нашем .

EasyEDA

Бесплатный и доступный в облачном инструменте EDA, позволяющий создавать схемы, моделировать SPICE и дизайн печатной платы. В его базе данных уже более 70 000 готовых диаграмм и более 15 тысяч библиотек PSpice, которые позволяют быстро рисовать диаграммы в веб браузере. Проекты, подготовленные в EasyEDA, могут быть опубликованы или сохранены в облаке. Файлы также можно экспортировать во многие форматы, включая JSON.

Программное обеспечение EasyEDA совместимо с инструментами Altium, Eagle KiCad и LTspice, откуда вы можете импортировать дополнительные библиотеки. По желанию производитель предлагает относительно недорогую конструкцию печатной платы в соответствии с созданной конструкцией. Благодаря доступу к приложениям в облаке мы получаем удобство, мобильность и совместимость между устройствами.

TinyCAD

Это программа для рисования схем в Windows, доступная для бесплатной загрузки с SourceForge. Поддерживает стандартные и пользовательские библиотеки символов. TinyCAD чаще всего используется для создания:

  • однолинейных диаграмм;
  • создания блок-схем;
  • разработки технических чертежей для целей презентации.

Xcircuit

Бесплатная программа для рисования схем из Open Circuit Designs, разработанная для среды Unix / Linux, но вы можете использовать ее в Windows, если у вас есть работающий сервер или Windows API. Существует множество бесплатных версий.

Dia

Это базовый инструмент проектирования с возможностью рисования блок-диаграмм. Dia — программа для начинающих, только для людей, входящих в область рисования электронных схем. Программа имеет лицензию GPL и доступна в версиях Mac и Linux (без версии для Windows). Чаще всего используется для построения блок-схем.

Pspice — Student Version

Бесплатная версия программного обеспечения Pspice была создана для студентов. Он содержит ограниченные версии таких продуктов, как: PSpice A / D 9.1, PSpice Schematics 9.1, Capture 9.1. Позволяет разрабатывать и моделировать аналоговые и цифровые схемы.

SmartDraw

Программные шаблоны проектирования электро схем из SmartDraw LCC, считается одним из лучших САПРОВ для рисования электронных схем, блок-схем, HVAC, и т.д.

Бесплатная версия SmartDraw представляет собой усеченный вариант платного программного обеспечения, в котором отсутствует расширенные функции.

1-2-3 схема

Это простая программа редактор для создания электро схем, которая позволит вам быстро и просто создать, и начертить любую схему любого уровня сложности. В приложении вы имеете возможность создавать электро схемы щитков для жилищных комплексов, стоит заметить, что программа на русском языке, поэтому удобна в применении.

1-2-3 схема является одним из бесплатных приложений, которое позволяет укомплектовывать электрощиты Хагер (Hager) оборудованием того же производителя. Основной особенностью программы относится такая функция, как сам по себе выбор корпуса для электрощита, который отвечает всем требованиям и нормам безопасности. Выбор производится непосредственно из ряда моделей Hager.

Более подробную информацию о программе вы можете найти на нашем .

Microsoft Visio

Основной задачей программы является разработка и создание с помощью шаблонов рисование разного рода электронных схем. Программа имеет возможность создавать:

  • разнообразные инженерные и технические рисунки;
  • электронные схемы;
  • составлять эффектные презентации;
  • разрабатывать организационные схемы, маркетинговые и многие другие.

Кроме широких возможностей, программа имеет богатый набор готовых элементов, шаблоны visio для электро схем, а также библиотеку красивых объемных рисунков. Создание различных электронных схем не является единственной задачей для MS Visio.

KiCad

Это пакет с открытым исходным кодом, который был создан французом Жан-Пьером Шаррас. Данное программное обеспечение включает в себя ряд интегрированных независимых программ, таких как:

  • kicad — приложение для управления проектами;
  • EESchema — расширенный редактор схем, с помощью которого можно создавать иерархические структуры;
  • Pcbnew — редактор для создания печатных плат на основе схемного дизайна;
  • gerbview — средство для просмотра файлов gerber и многие другие.

KiCad совместим со многими ОС, так как основан на библиотеке wxWidgets.

Более подробную информацию вы можете найти на нашем .

CadSoft Eagle

Высококачественная программа для проектирования печатных плат от немецкой компании CadSoft, входящей в состав Premier Farnell plc. EAGLE является аббревиатурой для легко применимого графического редактора макетов, что означает простой в использовании графический редактор.

CadSoft Eagle завоевала большую популярность из-за простоты и возможности использовать одну из версий — Eagle Light бесплатно. Бесплатная версия программы не позволяет создавать электронные схемы в коммерческих целях.

Программа доступна для операционных систем Windows, Linux, OS X.

Платное программное обеспечение для рисования электронных схем:

Ниже представлен список и краткое описание платных программ для проектирования электронных схем.

OrCAD

Самая популярная программа компании Cadence, содержащая полную среду для коммерческих проектов PCB, содержит все компоненты, необходимые для проектирования печатных плат, такие как:

  • модуль для введения схем;
  • редактор печатных плат с интегрированным управлением проектирования.

Чтобы повысить эффективность дизайна, программа предлагает интерактивную технологию проводки Push & Shove.

TINA-TI

Недорогое решение от DesignSoft, созданное для предприятий и фрилансеров. Он позволяет создавать:

  • схемы;
  • компоновку компонентов;
  • моделирование;
  • множество дополнительных функций.

Примечательной особенностью является также тестирование систем в режиме реального времени.

Altera

Предоставляет полный набор инструментов программирования для каждого этапа проекта, включая программные обеспечения:

  • NIOS II для проектирования встроенных систем;
  • DSP Builder для проектирования цифровых систем обработки сигналов;
  • Quartus II и ModelSim для построения логических систем.

Система Altera Max + Plus II (многоадресная матричная программируемая логическая пользовательская система) представляет собой интегрированную среду для проектирования цифровых схем в программируемых структурах. Система Max + Plus II включает 11 интегрированных прикладных программ.

Altium Designe

Комплект Altium Designer включает в себя четыре основных модуля:

  • редактор схем;
  • 3D- дизайн печатной платы;
  • разработка программируемой вентильной матрицы (FPGA) и управление данными.

Как правило, Altium Designer является дорогим ПО, но отличается способностью добиваться быстрых результатов для сложных схем.

P-Cad

Это программа для создания печатных плат и электронных схем. В пакет P-CAD входят два основных компонента:

  • P-CAD Schematic — редактор схем;
  • P-CAD pcb — редактор печатных плат.

На протяжении долгого времени данной программой пользовалось огромное количество российских разработчиков электронных схем, главной причиной этой популярности стал достаточно интуитивно понятный и удобный интерфейс. На данный момент производитель прекратил поддержку данного ПО, заместив ее программой Altium Designer.

Proteus Design Suite

Это полное программное решение для моделирования схем и проектирования печатных плат. Он содержит несколько модулей для схемного захвата, прошивки IDE и компоновки печатных плат, которые отображаются в виде вкладок внутри единого интегрированного приложения. Это обеспечивает плавный рабочий процесс AGILE для инженера проектировщика и помогает продуктам быстрее выйти на рынок.

Пробная версия приложения имеет полный функционал, но не имеет возможности сохранения файлов.

sPlan

Простой в использовании инструмент, который зарекомендовал себя в области инженерии, ремесел, образования, исследований и обучения. Он также стал полезным инструментом для многих частных пользователей.

Создавайте профессиональные планы за очень короткое время, от простой схемы до сложных планов. Особенностями данной программы являются:

  • расширяемая библиотека символов;
  • индивидуальные страницы с листами форм;
  • список компонентов;
  • автоматическая нумерация компонентов;
  • удобные инструменты рисования.

В бесплатной версии нельзя сохранять, экспортировать и печатать файлы.

Напишите в комментариях, какие программы для создания схем и дизайна электронных схем вы используете?

Этой статьей начинаю освещать одну из интереснейших тем это тема компьютерного, еще говорят, схемотехнического моделирования схем различных электронных устройств .

Вообще термин моделирование электронных схем имеет много синонимов, это и эмуляция электронных схем, симуляция электронных схем и т. д. Я буду придерживаться термина «компьютерное моделирование» или моделирование схем на компьютере, не суть важно.

Итак, поехали.

На сегодняшний день существуем множество компьютерных программ, которые предназначены в первую очередь для разработки различных электронных устройств и в таких программах существует одна из важных функций – эмуляция электрических схем.

Перечислю только самые известные из них:

LTSpice и множестов других программ.

Сегодня я хочу вас познакомить с программой компании National Instruments – это эмулятор схем Multisim.

Бесплатную программу Multisim с ограничениями на 50 элементов в схеме можно скачать с сайта производителя по ссылке https://lumen.ni.com/nicif/confirmation.xhtml, там же на сайте можно найти версию для учебных заведений, более расширенную по сравнению с предидущей, но тоже имеющую свои ограничения https://lumen.ni.com/nicif/us/academicevalmultisim/content.xhtml

Начнем с изучения интерфейса программы.

Основные функциональные панели программы показаны на следующем рисунке.

Отдельный интерес представляет панель компонентов. С помощью панели компонентов осуществляется доступ к базе компонентов. При нажатии на любую из выбранных пиктограмм компонентов схем открывается окно Выбор компонента . В левой части окна осуществляется выбор необходимого компонента.

Вся база данных компонентов разделена на разделы (пассивные элементы, диоды, транзисторы, микросхемы и т. д.), а разделы на семейства (например, для диодов – это сами диоды, стабилитроны, светодиоды, тиристоры и т. д.). Надеюсь идея понятна.

Так же в окне выбора компонента можно посмотреть обозначение выбранного компонента, описание его функции, выбрать тип корпуса.

Моделирование схем в программе Multisim.

Теперь переходим непосредственно к практике. Давайте соберем простую схему в программе Multisim и заставим ее работать!

Я скачал из интернета схему мультивибратора на двух транзисторах, где в качестве нагрузки используются светодиоды.

Можем воспользоваться измерительными приборами, например виртуальным осциллографом и посмотреть сигналы в различных точках схемы.

Мы убедились, что схема работает, на этом знакомство с программой Multisim заканчиваю, если вас заинтересовала тема моделирования схем, пишите свои вопросы в комментариях, отвечу с удовольствием.

Ну и на последок, по традиции представляю вам подробное видео по моделированию схем в программе Multisim.

Если вы еще не подписались на новые выпуски интернет журнала «Электрон», то заполняйте форму внизу страницы и получайте новые выпуски на электронную почту в формате PDF.

Qucs, также известный как Quite Universal Circuit Simulator, был разработан как доступный симулятор электронных цепей и контуров, имеющий графический интерфейс и основанный на открытом исходном коде. Программа поддерживает все виды моделирования схем, например DC, AC, S-параметры, гармонический анализ баланса, анализ шума и так далее. Результаты моделирования можно посмотреть на странице презентации или окне программы.

Qucsator, серверная часть программы, – это симулятор командной строки, который управляет списком сетей определенного формата ввода-вывода набора данных Qucs. По умолчанию он был создан для работы с проектом Qucs, но может быть использован и с другими приложениями. В программе есть поддержка экспорта изображений символов с файлами Verilog-A в код на языке C++, поддержка прямой связи с символами Verilog-HDL и подцепями VHDL. Последние версии Qucs обладают интерфейсом GNU/Octave.

Ключевые особенности и функции

  • поддержка синтаксиса Verilog-HDL и Verilog-A в текстовых документах;
  • поддержка экспорта кода на языке С++;
  • поддержка уравнений для подцепей Verilog-HDL и VHDL;
  • заранее скомпилированные VHDL модули и библиотеки;
  • поддержка всех современных компонентов;
  • открытый исходный код дает возможность разрабатывать расширения;
  • настраиваемый и расширяемый интерфейс;
  • встроенный файловый конвертер;
  • возможность загрузки дополнительных языков интерфейса.

Для проектирования и тестирования простых схем достаточно взять макетную плату и начать размещать на ней интересующие компоненты с возможностью быстрой замены того или иного элемента. Макетные платы позволяют легко проверить цепь на наличие ошибок перед пайкой готового продукта. Но если у вас более сложная схема или если вам нужно выполнить довольно непростое моделирование прохождения сигналов по вашему проекту, прежде чем вы начнете собирать конечное устройство, вам понадобится программное обеспечение для моделирования схем или попросту симулятор.

Основными требованиями, предъявляемыми большинством людей (особенно новичками в электронике) к симуляторам электронных схем, являются простота в использовании и как можно меньшая цена, в идеале вообще за бесплатно. Также очень важна функциональность.

Хотя легко получить пробную версию чего-то вроде OrCAD PSpice, это программное обеспечение не имеет всех доступных функций, если вы не хотите, конечно, раскошелиться с целью их приобретения. К счастью, есть абсолютно бесплатное полнофункциональное программное обеспечение для моделирования электронных схем, называемое Qucs (Quite Universal Circuit Simulator), выпущенное под лицензией GPL. Qucs предлагает достойную альтернативу другим платным симуляторам схем. Qucs запускает собственное программное обеспечение отдельно от SPICE, поскольку SPICE не лицензируется для повторного использования.

Qucs имеет большинство компонентов, которые вам понадобятся для моделирования на уровне близком профессиональному, а также это программное обеспечение имеет огромное количество различных моделей транзисторов. Саму программу можно найти на http://qucs.sourceforge.net/. Для более подробной информации на странице Qucs Wikipedia (https://en.wikipedia.org/wiki/Quite_Universal_Circuit_Simulator) перечислены все доступные функции, также имеется страница часто задаваемых вопросов.

По заверениям разработчиков Qucs еще не закончен полностью, и, скорее всего, функции будут добавляться время от времени, поэтому окончательной версии может и не быть, тем не менее, сегодня Qucs уже представляет собой очень функциональный инструмент для моделирования электронных схем. Графический интерфейс пользователя Qucs хорошо развит и позволяет настраивать схемы и представлять результаты моделирования в различных типах диаграмм. Скриншоты, представленные ниже, подтверждают это.


Бесплатные программы для черчения — что выбрать?

Черчение — важный и обязательный предмет для будущего технического специалиста. В настоящее время существует множество различных чертёжных программ, среди которых можно выделить профессиональные (платные) и упрощённые (бесплатные). Для вас мы приготовили обзор самых популярных и многофункциональных из них. Теперь вы сможете не только выполнять лёгкий эскиз, а также распечатывать готовый чертёж, просматривать и подправлять его в случае надобности, но и создавать свои проекты.

Блок: 1/11 | Кол-во символов: 482
Источник: https://dip-land.ru/articles/2017/04/besplatnyie-programmyi-dlya-chercheniya-chto-vyibrat/

Небольшой обзор САПР в целом

САПР – это система автоматизированного проектирования. На английском название сокращено до CAD, однако понимание этих терминов несколько разнится и в полной мере приравнять их не получится. Английский аналог подразумевает под собой использование технологий в проектировании, а не какую-либо конкретную систему. Поэтому в переводах часто можно увидеть не только привычное CAD, но и словосочетание CAD system.

Самыми популярными на российском рынке считаются AutoCAD, NanoCAD и «Компас». Они значительно лидируют по количеству скачиваний и установок. Представляют собой огромный набор средств, имеющий широкий выбор инструментов для проектирования и дополнительных модулей. О них мы поговорим в обязательном порядке.

Какой еще софт достоин детального рассмотрения? Многие архитекторы в силу обстоятельств нередко ищут ПО, являющееся качественным аналогом зарубежных разработчиков. Это не настолько непосильная задача, на самом деле, и мы в своей статье данное утверждение докажем примерами и подробными пояснениями.

Как называются лучшие программы для черчения на компьютере? Сейчас выясним. Но перед этим обозначим пункты, по которым будем их сравнивать.

Блок: 2/8 | Кол-во символов: 1191
Источник: http://www.zwsoft.ru/stati/programma-dlya-chercheniya-na-kompyutere

КОМПАС-3D (бесплатная)

Эта программа пользуется популярностью как у студентов, так и состоявшихся специалистов. Она имеет множество достоинств, среди которых, простой интерфейс, многофункциональность и хорошие справочные данные. Всё это позволяет создавать качественные и оригинальные проекты. Также 3D чертёж, КОМПАС-3D позволяет перенести в 2D и наоборот. А бонусом к ней можно считать дополнительные программные модули для создания электрических схем, трубопроводов, пружин и т.д.

Программа поддерживает распространённые форматы чертежей. Выполнена на русском языке и постоянно активно развивается и совершенствуется. Из минусов можно отметить дороговизну полной версии и ресурсоёмкость программы.

Блок: 2/11 | Кол-во символов: 698
Источник: https://dip-land.ru/articles/2017/04/besplatnyie-programmyi-dlya-chercheniya-chto-vyibrat/

Программы для черчения

Пользователям персонального компьютера доступен широкий спектр программ. Большей частью автоматизированных, что облегчает труд людей, дает прирост к производительности и качеству исходных схем. Ниже представлен список востребованных, доступных в освоении, функциональных приложений.

Производителем софта выступает компания Autodesk. Приложение популярно среди проектировочных отделов, автоматизированного моделирования и всего того, что связано с производством, монтажом и строительством. Устраиваясь на работу в серьезное предприятие, работнику придется иметь дело с AutoCAD. Программа доступна любителям, новичкам, профессионалам. Софт не стоит на месте, постоянно получая поддержку разработчиков. Ежегодно выходят обновленные версии с улучшенным функционалом, расширенными возможностями, усовершенствованным по замечаниям пользователей интерфейсом. Такое рачительное отношение производителя привело к популярности программного обеспечения.

Функциональные свойства

При работе на компьютере приложение разрешает создавать двухмерные и трехмерные проекты. Последние дают невиданную визуализацию, какой владеют продвинутые редакторы изображений.

Двухмерные модели, разработанные в AutoCAD, отличаются уникальностью. На выходе получаются подробные чертежи, где будут учтены все нюансы. Эксперты отмечают, что проекты, созданные на основе цифровых технологий Autodesk, отличаются качеством.

Три основных:

  • DWG – формат бинарных файлов, поддающийся редактированию, где хранятся трехмерные и двухмерные данные проекта.
  • DXF – открытый формат, который дает обмениваться данными между системами автоматизированного проектирования.
  • DWF – формат от «Autodesk». Обладает открытой структурой. Нужен для печати, просмотра и редактирования проектов.

Плюсы и минусы

Функции софта в полной мере реабилитируют его высокую стоимость. Компании и профессионалы-частники без сожаления расстаются с деньгами – программное обеспечение окупает вложения. Любители и новички чертежного дела предпочитают работать в издания с ограниченным функционалом или бесплатной ознакомительной версии, которая есть в сети и доступна для непосредственного скачивания.

Преимущества
  • Большое количество инструментов и разнообразных функций – настоящая Мекка для профессионалов и людей, которые увлекаются проектированием.
  • Реализована возможность интеграции с таблицами Excel.
  • Доступ к облачным хранилищам.
  • Поддержка большинства операционных систем, в том числе мобильных.
  • Интеграция с 3D-принтерами.
  • Присутствует возможность работы с макетами.
  • Наличие бесплатной версии.
Недостатки
  • Высокая стоимость полного продукта.
  • Высокие системные требования – не каждый компьютер потянет.

Сфера использования

Она обширна и с каждым годом увеличивается. Продукцию Autodesk применяют в строительстве, производстве, медицине, моделировании одежды – везде, где требуются чертежи отменного качества. Учебные заведения различной направленности посвящают обучению AutoCAD немало времени.

Блок: 2/4 | Кол-во символов: 2925
Источник: https://akmartis.ru/programmy/programma-dlya-chercheniya-na-kompyutere-obzor.html

На какие характеристики стоит обратить свое внимание

Дотошный эксперт обязательно оценит не только функционал, но и другие важные критерии ПО. Что входит в этот список?

  • Сложность. Некоторый софт не рассчитан на новичков и разобраться в нем самостоятельно бывает достаточно трудно. Чтобы не переоценить свои силы, лучше начать с чего-то более простого или попросить помощи у коллег.
  • Год создания, компания. Это важно, так как инструментарий должен отвечать всем современным требованиям. Репутация фирмы играет немаловажную роль при выборе лучшей компьютерной программы для черчения.
  • Отрасль применения. Казалось бы, а на что это может влиять? Создавать модели можно, начертить схему – тем более, так зачем исходить из какой-либо специализации? Многие разработчики включают инструментарий, который может быть весьма полезен, например, только архитектору.
  • Цена. Аргумент весомый, и может значительно повлиять на ваш выбор. Найти ПО, отвечающее всем запросам, по приемлемой стоимости сложно. Обратите свое внимание на ZWCAD – он хорошо вписывается в эти параметры, об этом софте мы расскажем чуть ниже.

Выделив все важные критерии, приступим к подробному анализу.

Блок: 3/8 | Кол-во символов: 1170
Источник: http://www.zwsoft.ru/stati/programma-dlya-chercheniya-na-kompyutere

AutoCAD (бесплатная пробная версия)

Вторая по популярности инженерная программа, но более сложная в освоении. Используется для решения серьёзных профессиональных задач по промышленному проектированию, архитектурному и дизайнерскому черчению. В то же время эта программа доступна для изучения и рядовым пользователем. AutoCAD позволяет проставить на чертежах размеры, исправить небольшие ошибки готового чертежа, а также по заданным размерам фигур вести их построение в автоматическом режиме.

Принцип работы заключается в построении чертёжного проекта из 2D и 3D компонентов. Позволяет создать как самый простой чертёж, так и сложный механизм. Работает с тремя форматами: DWF, DWG и DXF.

В отличие от предыдущей программы, AutoCAD не работает с российской системой ЕСКД, а предлагает только международную. Также к минусам можно отнести и дороговизну полнофункциональной версии.

Блок: 3/11 | Кол-во символов: 873
Источник: https://dip-land.ru/articles/2017/04/besplatnyie-programmyi-dlya-chercheniya-chto-vyibrat/

«Компас» – программа для черчения простых чертежей на русском

Отличительной чертой данного ПО выступает возможность проводить вычисления. Многие из них ориентируются на сигнатуры, установленные стандартами ГОСТ. А потому схемы и модели сразу же отвечают всем требованиям нашего законодательства.

Компания «Аскон» начала свою работу на пару лет позже, чем Autodesk, однако это никак не влияет на качество созданного ими продукта.

Функционал

Данное ПО способно распознавать широкий круг форматов. Это стало возможно благодаря тесному сотрудничеству фирмы с различными проектными бюро.

Еще одна важная и интересная особенность: автоматически собирается документ, в котором описаны все заданные технические характеристики той или иной модели.

Преимущества и недостатки

Эта достаточно простой софт для черчения чертежей и планов на компьютере имеет свои как положительные черты, так и отрицательные. Давайте посмотрим на них.

Плюсы «Компаса» многие пользователи выделяют следующие:

  • Вся программа полностью прописана на русском языке. Все инструкции и справки непосредственного из этого ПО тоже. Поэтому проблема языкового барьера новоиспеченным специалистам не грозит.
  • Возможность подключения библиотек в соответствии с профилем.
  • Очень проста для освоения, подходит даже новичкам для самостоятельного изучения.

Минусы практически те же, что и у предыдущего ПО. По стоимости обойдется по цене новенького IPhone и дороже в несколько раз (зависит от комплектации), а по производительности – ПК должен тянуть ПО с огромным функционалом в несколько гигабайт. Еще один ощутимый недостаток: отсутствие прямой поддержки формата DWG.

Версии софта

Этот пункт необходимо вынести в отдельный заголовок, так как разработчики предлагают сразу несколько версий (и это можно отнести к плюсам): для настоящих профи и для тех, кому нужна облегченный вариант с меньшим функционалом.

На данный момент существует тенденция обращения к аналогам описанному перед этим софтом. И не мудрено: они намного дешевле, хотя инструментарий и мощность ПО никак не уступает параметрам AutoCAD. 

Блок: 5/8 | Кол-во символов: 2069
Источник: http://www.zwsoft.ru/stati/programma-dlya-chercheniya-na-kompyutere

A9CAD (бесплатная)

Это чертёжно-графическая программа для 2D-проектирования. Быстро устанавливается и осваивается. Выполнена на английском языке. К основным возможностям A9CAD можно отнести создание двухмерных чертежей разной сложности, нанесение размеров, работу со слоями и другое. Программа имеет сходный интерфейс с AutoCAD, доступный для понимания любым пользователем Windows.

Блок: 5/11 | Кол-во символов: 380
Источник: https://dip-land.ru/articles/2017/04/besplatnyie-programmyi-dlya-chercheniya-chto-vyibrat/

CorelDRAW Technical Suite (условно бесплатная)

Большая комплексная программа, позволяющая работать как с техническими чертежами, так и обладающая возможностями графического дизайна. Также с её помощью можно разрабатывать всевозможную техническую документацию — учебные руководства и справочники.

CorelDRAW Technical Suite найдёт применение в руках архитекторов, инженеров, дизайнеров и даже модельеров, так как специализированные инструменты рисования позволяют создавать и иллюстрации. Программа направлена на работу с трёхмерными и двумерными моделями. Выполнена на английском языке.

Блок: 6/11 | Кол-во символов: 583
Источник: https://dip-land.ru/articles/2017/04/besplatnyie-programmyi-dlya-chercheniya-chto-vyibrat/

Какая программа для черчения лучше: поговорим об аналогах «Автокада»

Не все готовы потратить большие деньги ради широкого функционала и своего же удобства. Да и зачем переплачивать, если есть аналогичные отечественные продукты. К примеру, по цене и своим характеристикам на рынке значительно выделяется ZWCAD.

Разработкой этого продукта занимается китайская компания ZWSOFT. Реализация в России осуществляется благодаря ООО «ЗВСОФТ», продвигающей это ПО с 2007 года. Компания очень ответственно подходит к каждому своему клиенту:

  • Работает техническая служба поддержки, которая отвечает на все вопросы и помогает подобрать необходимый дополнительный модуль.
  • Консультации проводятся как до покупки, так и после нее. К пользователям программы фирма относится с высокой долей ответственности и старается свести появление трудностей в эксплуатации на ноль.
  • Актуальные новости на главной странице сайта всегда помогают поддерживать софт в обновленном состоянии.

С наградами и сертификатами можно ознакомиться здесь. Репутация у компании серьезная, так как все сотрудники заинтересованы в продвижении общего дела – это видно по отношению фирмы к клиентам.

Функциональная составляющая

Существует несколько версий софта: стандартный набор, профессиональный и классический. Большой популярностью пользуются первые два варианта, так как они включают в себя широкий выбор инструментов для создания качественного макета или проекта.

Основная специализация – 2D- и 3D-моделирование, поддержка распространенных видов форматов.

Преимущества ZWCAD

  • Чтобы убедиться в качестве предоставляемого продукта, используйте бесплатную версию на ограниченное количество дней.
  • Стандартная – открывает все виды файлов, которые поддерживает и «Автокад»: DWG, DXF, DWT.
  • Вы можете выбрать один или несколько режимов редактирования с помощью «ручек» объектов: разработчики ввели в ПО 5 вариантов. Вам остается только использовать тот, который необходим.
  • Возможность интеграции с различными внешними предложениями и платформами: список зависит от выбранной вами версии.
  • Тонкая настройка окружения чертежа и переключение интерфейсов: все можно настроить индивидуально под каждого специалиста.
  • И самое главное – это цена. Она ниже стоимости своего основного конкурента – вы сами выбираете нужную версию и оплачиваете ее.
  • Функционал, команды и интерфейс достаточно приближен к «Автокаду», а потому людям, привыкшим к этому ПО, удобно переходить на софт от ZWSOFT.

К недостаткам стоит отнести подвисание компьютера со старыми или поврежденными системными блоками и необновленным ПО от компании-производителя.

Данная сравнительная таблица даст полное представление о преимуществах и недостатках, так как в ней подробно рассмотрены все функции, которые способен поддерживать этот софт.

Нельзя однозначно сказать, какие программы наиболее легкие для строительного черчения. Все зависит от ваших личных предпочтений и финансовых возможностей. ZWCAD – отличный вариант для тех покупателей, которые ищут удобную и практичную в использовании утилиту по приемлемой цене.

Чтобы ознакомиться с продуктом компании ZWSOFT или заказать для себя бесплатную версию, позвоните по телефону, указанному на сайте, или обратитесь в онлайн-чат. Сотрудники с радостью ответят на все ваши вопросы и дадут подробную консультацию.

Блок: 7/8 | Кол-во символов: 3314
Источник: http://www.zwsoft.ru/stati/programma-dlya-chercheniya-na-kompyutere

VariCAD (условно бесплатная)

Предназначена в первую очередь для машиностроительного проектирования. В ней можно моделировать различные графические объекты в 2D и 3D, импортировать и экспортировать такие форматы чертежей, как DXF, IGES, STEP, STL и DWG. Есть инструменты для обработки листового материала, библиотеки стандартных механических частей, возможность инженерных расчётов и другое. Выполнена на английском языке.

Блок: 7/11 | Кол-во символов: 420
Источник: https://dip-land.ru/articles/2017/04/besplatnyie-programmyi-dlya-chercheniya-chto-vyibrat/

Остались вопросы? Задайте их здесь

или присоединяйтесь к нашей группе в соцсети

Блок: 8/8 | Кол-во символов: 192
Источник: http://www.zwsoft.ru/stati/programma-dlya-chercheniya-na-kompyutere

LibreCAD (бесплатная)

Программа рассчитана в основном на создание машиностроительных чертежей и архитектурных планов. Интерфейс понятен и легко настраивается. LibreCAD имеет широкий набор различных инструментов для проектирования и редактирования чертежей любой сложности. И может быть использована как для создания малых объектов (молекулы), так и для составления двухмерных карт звёздного неба, например.

Есть поддержка слоёв, функции группировки объектов, привязки и многое другое. Выполнена в том числе и на русском языке.

Блок: 8/11 | Кол-во символов: 524
Источник: https://dip-land.ru/articles/2017/04/besplatnyie-programmyi-dlya-chercheniya-chto-vyibrat/

Graphite (условно бесплатная)

Предназначена для создания двух- и трёхмерных чертежей и схем, различной сложности и степени детализации. Программа имеет множественный функционал и инструменты для быстрого и точного создания чертежей. Есть система привязок в пространстве, возможность создания пользовательских библиотек, гибкое задание размеров и многое другое.

Эта программа подойдёт для студентов технических вузов, инженеров и рядовых пользователей. Она позволяет создавать многостраничные PDF-документы и обеспечивает точный импорт и экспорт чертежей в популярных САПР форматах. Выполнена в том числе и на русском языке.

Блок: 9/11 | Кол-во символов: 621
Источник: https://dip-land.ru/articles/2017/04/besplatnyie-programmyi-dlya-chercheniya-chto-vyibrat/

FreeCAD (бесплатная)

Развивающийся проект, направленный на полноценную замену дорогостоящих систем САПР и предназначенный для параметрического 3D-моделирования в машиностроении. Также эту программу можно использовать и для решения других задач: создание чертежей, архитектурного моделирования, в астрономии и т.д. Нужно учесть, что в качестве основного формата для сохранения документов, программа использует свой собственный стандарт — FCStd.

К основным возможностям программы FreeCAD можно отнести возможность импорта огромного количества форматов файлов, поддержку графических форматов, наличие множества инструментов для черчения, логические операции, поддержка экспортов в PDF, поддержка печати и многое другое. Выполнена в том числе и на русском языке.

Блок: 10/11 | Кол-во символов: 756
Источник: https://dip-land.ru/articles/2017/04/besplatnyie-programmyi-dlya-chercheniya-chto-vyibrat/

DraftSight (бесплатная)

Программа для черчения профессионального уровня, которая легка и понятна в использовании. Будет полезна для тех студентов, которым приходится много чертить, может заменить платный аналог AutoCAD или КОМПАС-3D. DraftSight предназначена для работы с 3D-моделями в формате dwg/dxf, а также для выполнения технологических задач. Выполнена в том числе на русском языке.

Кроме этих программ широкого спектра, есть узконаправленные. Например, для черчения электрических схем: DSSim-PC, sPlan, Circuit Diagram и для автоматизированного проектирования микросхем — ExpressPCB.

А если вам нужно просто просмотреть чертёж, изменить на нём размеры, нанести электронные пометки, зуммировать изображение или напечатать, то для этого можно использовать бесплатные и условно-бесплатные просмотрщики на русском и английском языках:

Вот основные бесплатные и условно-бесплатные программы для черчения. Какой из них доверить выполнение вашего задания будет зависеть от поставленной задачи и необходимого решения. Выбор за вами.

Блок: 11/11 | Кол-во символов: 1030
Источник: https://dip-land.ru/articles/2017/04/besplatnyie-programmyi-dlya-chercheniya-chto-vyibrat/

Кол-во блоков: 17 | Общее кол-во символов: 17228
Количество использованных доноров: 3
Информация по каждому донору:
  1. http://www.zwsoft.ru/stati/programma-dlya-chercheniya-na-kompyutere: использовано 5 блоков из 8, кол-во символов 7936 (46%)
  2. https://akmartis.ru/programmy/programma-dlya-chercheniya-na-kompyutere-obzor.html: использовано 1 блоков из 4, кол-во символов 2925 (17%)
  3. https://dip-land.ru/articles/2017/04/besplatnyie-programmyi-dlya-chercheniya-chto-vyibrat/: использовано 10 блоков из 11, кол-во символов 6367 (37%)

В какой программе рисовать схемы


Обзор 20 лучших программ для черчения электрических схем

Времена применения кульманов давно миновали, их заменили графические редакторы, это специальные программы для черчения электрических схем. Среди них есть как платные приложения, так и бесплатные (виды лицензий мы рассмотрим ниже). Уверены, что созданный нами краткий обзор поможет из разнообразия программных продуктов выбрать ПО, наиболее оптимальное для поставленной задачи. Начнем с бесплатных версий.

Бесплатные

Прежде, чем перейти к описанию программ кратко расскажем о бесплатных лицензиях, наиболее распространены из них следующие:

  • Freeware – приложение не ограничено по функциональности и может использоваться в личных целях без коммерческой составляющей.
  • Open Source – продукт с «открытым кодом», в который допускается вносить изменения подстраивая ПО под собственные задачи. Возможны ограничения на коммерческое использование и платное распространение внесенных модификаций.
  • GNU GPL – лицензия практически не накладывающая на пользователя никаких ограничений.
  • Public domain – практически идентична с предыдущим вариантом, на данный тип лицензии закон защиты авторских прав не распространяется.
  • Ad-supported – приложение полностью функционально, содержит в себе рекламу других продуктов разработчика или других компаний.
  • Donationware – продукт распространяется бесплатно, но разработчик предлагает внести пожертвования на добровольной основе для дальнейшего развития проекта.

Получив представление о бесплатных лицензиях можно переходить к ПО, распространяемому на таких условиях.

Microsoft Visio

Это простой в управлении, но в то же время весьма удобный редактор векторной графики, обладающий богатым функциональным набором. Несмотря на то, что основная социализация программы визуализация информации с приложений MS Office, ее вполне можно использовать для просмотра и распечатки радиосхем.

Интерфейс Microsoft Visio практически такой же, как в MS Office

MS выпускает три платных версии, отличающихся функциональным набором и бесплатную (Viewer), которая интегрируется в браузер IE и позволяет с его помощью осуществлять просмотр файлов, созданных в редакторе. К сожалению, для редакции и создания новых схем потребуется приобрести полнофункциональный продукт. Заметим, что даже в платных версиях среди базовых шаблонов нет набора для полноценного создания радиосхем, но его несложно найти и установить.

Недостатки бесплатной версии:

  • Недоступны функции редактирования и создания схем, что существенно снижает интерес к этому продукту.
  • Программа работает только с браузером IE, что также создает массу неудобств.

Официальная страница: https://products.office.com/ru-ru/visio

Компас-Электрик

Данная ПО является приложением к САПР российского разработчика «АСКОН». Для ее работы требуется установка среды КОМПАС-3D. Поскольку это отечественный продукт, в нем полностью реализована поддержка принятых России ГОСТов, и, соответственно, нет проблем с локализацией.

Компас-Электрик – полностью российская разработка

Приложение предназначено для проектирования любых видов электрооборудования и создания к ним комплектов конструкторской документации.

Это платное ПО, но разработчик дает 60 дней на ознакомление с системой, в течение этого времени ограничения по функциональности отсутствуют. На официальном сайте и в сети можно найти множество видео материалов, позволяющих детально ознакомиться с программным продуктом.

В отзывах многие пользователи отмечают, что в системе имеется масса недоработок, которые разработчик не спешит устранять.

Официальный сайт: https://kompas.ru/kompas-3d/application/instrumentation/electric/

Eagle

Данное ПО представляет собой комплексную среду, в которой можно создать как принципиальную схему, так и макет печатной платы к ней. То есть, расположить на плате все необходимые элементы и выполнить трассировку. При этом, она может быть выполнена как в автоматическом, так и ручном режиме или путем комбинации этих двух способов.

Cadsoft Eagle – хороший пример комплексного решения

В базовом наборе элементов отсутствуют модели отечественных радиокомпонентов, но их шаблоны могут быть скачены в сети. Язык приложения – Английский, но локализаторы, позволяющие установить русский язык.

Приложение является платным, но возможность его бесплатного использования со следующими функциональными ограничениями:

  • Размер монтажной платы не может превышать размера 10,0х8,0 см.
  • При разводке можно манипулировать только двумя слоями.
  • В редакторе допускается работа только с одним листом.

Сайт программы: https://www.autodesk.com/products/eagle/free-download

Dip Trace

Это не отдельное приложение, а целый программный комплекс, включающий в себя:

  • Многофункциональный редактор для разработки принципиальных схем.
  • Приложение для создания монтажных плат.
  • 3D модуль, позволяющий проектировать корпуса для созданных в системе приборов.
  • Программу для создания и редактирования компонентов.
DipTrace – система сквозного проектирования

В бесплатной версии программного комплекса, для некоммерческого использования, предусмотрены небольшие ограничения:

  • Монтажная плата не более 4-х слоев.
  • Не более одной тысячи выводов с компонентов.

В программе не предусмотрена русская локализация, но ее, а также описание всех функций программного продукта можно найти в сети. С базой компонентов также нет проблем, в изначально их около 100 тыс. На тематических форумах можно найти созданные пользователями базы компонентов, в том числе и под российские ГОСТы.

Страница программы: https://diptrace.com/rus/

1-2-3 схема

Это полностью бесплатное приложение, позволяющее укомплектовать электрощиты Хагер (Hager) одноименным оборудованием.

ПО «1-2-3 схема» разработка компании Hager для комплектации своих электрощитов

Функциональные возможности программы:

  • Выбор корпуса для электрощита, отвечающего нормам по степени защиты. Выборка производится из модельного ряда Hager.
  • Комплектация защитным и коммутационным модульным оборудованием того же производителя. Заметим, что в элементной базе присутствуют только сертифицированные в России модели.
  • Формирование конструкторской документации (однолинейной схемы, спецификации, отвечающей нормам ЕСКД, отрисовка внешнего вида).
  • Создание маркеров для коммутирующих устройств электрощита.

Программа полностью локализована под русский язык, единственный ее недостаток, что в элементной базе присутствует только электрооборудование компании-разработчика.

http://www.hagersystems.ru/software/

Autocad Electrical

Приложение на базе известной САПР Autocad, созданное для проектирования электросхем и создания для них технической документации в соответствии с нормами ЕСКД.

В Autocad Electrical богатый выбор электрических компонентов

Изначально база данных включает в себя свыше двух тысяч компонентов, при этом, их условно графические обозначения отвечают действующим российским и европейским стандартам.

Данное приложение платное, но имеется возможность в течение 30-ти дней ознакомиться с полным функционалом базовой рабочей версии.

https://www.autodesk.ru/products/autocad-electrical/overview

Эльф

Данное ПО позиционируется в качестве автоматизированного рабочего места (АРМ) для проектировщиков-электриков. Приложение позволяет быстро и корректно разработать, практически, любой чертеж для электротехнических проектов с привязкой к плану помещений.

Функционал приложения включает в себя:

  • Расстановку УГО при проектировании электросетей, проложенных открыто, в трубах или специальных конструкциях.
  • Автоматический (с плана) или руной расчет силовой схемы.
  • Составление спецификации в соответствии с действующими нормами.
  • Возможность расширения базы элементов (УГО).
Пример схемы, созданной в редакторе Эльф

В бесплатной демонстрационной версии отсутствует возможность создания и редактирование проектов, их можно только просмотреть или распечатать.

Официальный сайт: http://old.rflira.ru/products/nets/1258965991.html

Kicad

Это полностью бесплатный программный комплекс с открытым кодом (Open Source). Данное ПО позиционируется в качестве системы сквозного проектирования. То есть, можно разработать принципиальную схему, по ней создать монтажную плату и подготовить документацию, необходимую для производства.

KiCad одна из немногих бесплатных систем сквозного проектирования

Характерные особенности системы:

  • Для разводки платы допускается применение внешних трассировщиков.
  • В программу встроен калькулятор печатной платы, размещение на ней элементов можно выполнить автоматически или вручную.
  • По завершению трассировки система генерирует несколько технологических файлов (например, для фотоплоттера, сверлильного станка и т.д.). При желании можно добавить логотип компании на печатную плату.
  • Система может создать послойную распечатку в нескольких популярных форматах, а также сгенерировать список используемых в разработке компонентов для формирования заказа.
  • Имеется возможность экспорт чертежей и других документов в форматы pdf и dxf.

Заметим, что многие пользователи отмечают непродуманность интерфейса системы, а также тот факт, что для освоения ПО требуется хорошо изучить документацию к программе.

Страничка программы: http://kicad-pcb.org/

TinyCAD

Еще одно бесплатное приложение с открытым кодом, позволяющее создавать чертежи принципиальных схем и имеющее функции простого редактора векторной графики. В базовом наборе содержится сорок различных библиотек компонентов.

TinyCAD – простой редактор для принципиальных схем

В программе не предусмотрена трассировка печатных плат, но имеется возможность экспортировать список соединений в стороннее приложение. Экспорт производится с поддержкой распространенных расширений.

Приложение поддерживает только английский язык, но благодаря интуитивному меню проблем с освоением не возникнет.

https://sourceforge.net/projects/tinycad/files/

Fritzing

Бесплатная среда разработки проектов на базе Arduino. Имеется возможность создания печатных плат (разводку необходимо делать вручную, поскольку функция автотрассировки откровенно слабая).

Приложение Fritzing позволит быстро спроектировать любое устройство на базе Arduino

Следует заметить, что приложение «заточено» для быстрого создания набросков, позволяющих объяснить принцип работы проектируемого прибора. Для серьезной работы у приложения слишком мала база элементов и сильно упрощенное составление схемы.

http://fritzing.org/home/

123D Circuits

Это веб-приложение для разработки Arduino-проектов, с возможностью программирования устройства, симуляции и анализа его работы. В типовом наборе элементов присутствуют только основные радио-компоненты и модули Arduino. При необходимости пользователь может создать новые компоненты и добавить их в базу. Примечательно, что разработанную печатную плату можно заказать, непосредственно, в онлайн-сервисе.

Виртуальная среда разработки 123D Circuits

В бесплатной версии сервиса нельзя создавать свои проекты, но можно просматривать чужие разработки, находящиеся в открытом доступе. Для полноценного доступа ко всем возможностям необходимо оформить подписку ($12 или $24 в месяц).

Заметим, что из-за бедного функционала виртуальная среда разработки вызывает интерес только у начинающих. Многие из тех, кто пользовался сервисом, обратили внимание на тот факт, что результаты симуляции расходятся с реальными показателями.

https://circuits.io/

XCircuit

Бесплатное мультиплатформенное приложение (лицензия GNU GPL) для быстрого создания принципиальных схем. Функциональный набор минимальный.

XCircuit – простой редактор с минимумом функций

Язык приложения – английский, программа не воспринимает русские символы. Также следует обратить внимание на нетипичное меню, к которому необходимо привыкнуть. Помимо этого контекстные подсказки выводятся на панель состояния. В базовый набор элементов входят УГО только основных радиодеталей (пользователь может создать свои элементы и добавить их).

http://opencircuitdesign.com/xcircuit/

CADSTAR Express

Это демонстрационная версия одноименной САПР. Функциональные ограничения коснулись лишь числа элементов, используемых в схеме разработки (до 50 шт) и количеств контактов (не более 300), что вполне достаточно для небольших радиолюбительских проектов.

Фрагмент рабочего окна приложения GADSTAR Express

Программа состоит из центрального модуля, в которых входит несколько приложений позволяющих разработать схему, создать для нее плату и подготовить пакет технической документации.

В базовый набор входит более 20 тыс. компонентов, дополнительно можно загрузить с сайта разработчика дополнительные библиотеки.

Существенным недостатком системы является отсутствие поддержки русского языка, соответственно, все техническая документация также представлена в сети на английском.

https://www.zuken.com/en/products/pcb-design/cadstar/resources

QElectroTech

Простое удобное и бесплатное (FreeWare) приложения для разработки электрических и электронных схем-чертежей. Программа является обычным редактором, никаких специальных функций в ней не реализовано.

QElectroTech – программа для составления, просмотра и печати электросхем

Язык приложения – английский, но для него имеется русская локализация.

https://qelectrotech.org/download.html

Платные приложения

В отличие от ПО, распространяемого по бесплатным лицензиям, коммерческие программы, как правило, обладают значительно большим функционалом, и поддерживаются разработчиками. В качестве примера мы приведем несколько таких приложений.

sPlan

Простая программа-редактор для черчения электросхем. Приложение комплектуется несколькими библиотеками компонентов, которые пользователь может расширять по мере необходимости. Допускается одновременная работа с несколькими проектами, путем их открытия в отдельных вкладках.

sPlan – удобный графический редактор для электрических схем

Чертежи, сделанные программой, хранятся в виде файлов векторной графики собственного формата с расширением «spl». Допускается конвертация в типовые растровые форматы изображения. Имеется возможность печати больших схем на обычном принтере А4-го формата.

Официально приложение не выпускается в русской локализации, но существуют программы, позволяющие русифицировать меню и контекстные подсказки.

Помимо платной версии предусмотрены две бесплатных реализации Demo и Viewer. В первой нет возможности сохранить и распечатать нарисованную схему. Во второй предусмотрена только функция просмотра и печати файлов формата «spl».

https://www.electronic-software-shop.com/splan-70.html

Eplan Electric

Многомодульная масштабируемая САПР для разработки электротехнических проектов различной сложности и автоматизации процесса подготовки конструкторской документации. Данный программный комплекс сейчас позиционируется в качестве корпоративного решения, поэтому для рядовых пользователей он будет не интересен, особенно если принять в учет стоимость ПО.

Фрагмент рабочего окна САПР Eplan Electriс Р8

https://www.eplan-russia.ru/ru/reshenija/ehlektrotekhnicheskoe-proektirovanie/eplan-electric-p8/

Target 3001

Мощный САПР комплекс, позволяющий разрабатывать электросхемы, трассировать печатные платы, моделировать работу электронных устройств. Онлайн библиотека компонентов насчитывает более 36 тыс. различных элементов. Данная CAD широко применяется в Европе для трассировки печатных плат.

САПР Target 3001

По умолчанию устанавливается английский язык, имеется возможность установить меню на  немецком или французском, официально русской локализации нет. Соответственно, вся документация представлена только на английском, французском или немецком языке.

Стоимость самой простой базовой версии около 70 евро. За эти деньги будет доступна трассировка двух слоев на 400 выводов. Стоимость нелимитированной версии в районе 3,6 тыс. евро.

https://ibfriedrich.com/en/index.html

Micro-Cap

Приложение для моделирования цифровых, аналоговых и смешанных схем, а также анализа их работы. Пользователь может создать в редакторе электрическую цепь и задать параметры для анализа. После это по одному клику мышки система автоматически чего произведет необходимые расчеты и выдаст результаты для изучения.

Micro-Cap – одно из лучших приложений для моделирования электросети

Программа позволяет установить зависимость параметров (номиналов) элементов от температурного режима, освещенности, частотных характеристик и т.д. Если в схеме присутствуют анимированные элементы, например, светодиодные индикаторы, то их состояние будут корректно отображаться, в зависимости от поступающих сигналов. Имеется возможность при моделировании «подключать» к схеме виртуальные измерительные приборы, а также отслеживать состояние различных узлов устройства.

Стоимость полнофункциональной версии около $4,5 тыс. Официальной русской локализации приложения не существует.

http://www.spectrum-soft.com/index.shtm

TurboCAD

Данная САПР платформа включает в себя множество инструментов, для проектирования различных электрических устройств. Набор специальных функций позволяет решать инженерно-конструкторские задачи любого уровня сложности.

Платформа TurboCAD может использоваться для решения многих задач

Отличительные особенности – тонкая настройка интерфейса под пользователя. Множество справочной литературы, в том числе и на русском языке. Несмотря на отсутствие официальной поддержки русского языка, для платформы имеются русификаторы.

Для рядовых пользователей приобретение платной версии программы с целью разработки электросхем для любительских устройств, будет нерентабельно.

https://www.turbocad.com/

Designer Schematic

Приложение для создания электросхем с использованием радиоэлементов производства Digi-Key. Основная особенность данной системы заключается в том, что в редакторе для построения схем, может использовать механическое проектирование.

Интерфейс Designer Schematic не отличается сложностью

Базы данных компонентов можно в любой момент проверить на соответствие и при необходимости произвести обновление прямо с сайта производителя.

Система не имеет собственного трассировщика, но список соединений может быть загружен в стороннюю программу.

Имеется возможность импорта файлов из популярных САПР.

Ориентировочная стоимость приложения около $300.

https://www.digikey.com/schemeit/project/

Как нарисовать схему на компьютере

Инструкция

Обычную простейшую блок-схему вы сможете начертить, если у вас на компьютере установлен текстовый редактор Word, один из модулей популярного Microsoft Office. До того как нарисовать схему на компьютере, продумайте, как будут расположены ее основные элементы, их форму и то, каким образом она будет сориентирована – как «портрет» или как «альбом». В старых версиях Word чертить блок-схемы можно было, активировав панель «Рисование», выбирая на ней различные геометрические фигуры, тип стрелок, рамок и соединительных линий. Чтобы рисовать блок-схемы в новых версиях Word, выберите вкладку «Вставка» на верхней панели и активируйте пункт меню «Фигуры».

Нажмите на кнопку «Фигуры». В выпадающем меню вы увидите весь арсенал графических средств, которыми вы можете пользоваться для рисования схем. Это основные геометрические фигуры, в форме которых могут быть нарисованы рамки, а также линии, фигурные стрелки и выноски разного типа. Размер и расположение каждой фигуры вы можете менять как вам необходимо, перемещая по странице и растягивая с помощью мышки.

Чтобы сделать надпись в заданных фигурами рамках, активируйте текстовую функцию, выделив рамку и щелкнув левой клавишей мышки на иконке с изображением текста в верхнем меню. Выделив любой элемент из тех, что составляют схему, вы также можете изменить стиль его оформления, выбрать цвета заливки, рамки, текста.

Радиолюбителю может потребоваться нарисовать схему немного более сложную, чем те, которые предлагает Word. В этом случае прекрасно подойдет графический редактор sPlan версии 6.0 или 5.0. Эту бесплатную программу найдите и скачайте в интернете. Установите редактор на ваш компьютер и запустите его. В левой боковой панели вы увидите целую библиотеку графических элементов, которые разбиты по категориям: реле, микросхемы, конденсаторы и т.п. Щелкните по необходимому вам элементу левой кнопкой мышки и перетащите его на схему, расположив в необходимом месте.

В редакторе sPlan также есть возможность рисования блок-схем и расположения надписей в их элементах. Чтобы соединить детали схем, выберите любой тип линий, задав их толщину на соответствующей панели. Сохранить схему вы сможете во внутреннем формате программы. Также есть возможность сохранить ее как изображение, чтобы переслать по электронной почте или разместить в интернете.

Источники:

Лучшие простые программы для черчения на компьютере

Если Вам нужна простая программа для черчения, то Вы попали по адресу. Мы составили список из пяти самых простых образцов ПО, которыми пользуются люди, занимающиеся 2D и 3D моделированием.

Выбирали мы их по одному простому критерию – простоте использования. Чтобы понять, действительно ли та или иная программа является легкой в использовании, мы запустили ее самостоятельно, а также прочитали множество отзывов с самых разных сайтов.

Какая из них самая простая, пусть каждый выберет сам. Но у всех из них есть свои преимущества и недостатки.

Содержание:

  1. SketchUp
  2. NanoCAD
  3. A9CAD
  4. ABViewer
  5. FreeCAD

 

1. SketchUp

Это программа от корпорации Google с интерфейсом на русском языке. В ней есть все самое необходимое чтобы начать работу в мире моделирования – стандартный набор инструментов, простейший интерфейс (никаких скрытых меню и непонятных функций), а также подробная справка.

Что касается последнего, то помимо обычного для любой хорошей программы списка типичных вопросов и ответов, в SketchUp есть также набор видеоуроков. 

С их помощью каждый сможет увидеть, как работать с программой, где и какие инструменты у нее находятся, что нужно чтобы их использовать и так далее. Главное, что все это наглядно, а не просто в виде текста.

Также в видеоуроках пользователь сможет увидеть, как работают настоящие профессионалы в данной области. В общем, для новичков здесь есть все что нужно!

Вот еще несколько особенностей SketchUp:

  • Есть собственный форум, поэтому все вопросы, ответов на которые нет в справочном центре (хотя это маловероятно), можно задать там. Ответ дадут реальные люди – такие же пользователи или эксперты Google.
  • Существует набор расширений для увеличения функционала. Благодаря таковому можно сделать из ПО для черчения, которым пользуются новички, в настоящий профессиональный набор инструментов.
  • Огромная библиотека собственных объектов, которые есть в свободном доступе. 

 

Рис. №1. SketchUp

В общем, SketchUp – это лучшая программа, чтобы начать чертить! Да, в ней нет такого богатого функционала, зато все просто и понятно. После SketchUp можно переходить на что-то более сложное.

Ссылка на скачивание 

2. NanoCAD

Существует тяжеловес в области ПО для черчения и называется он КОМПАС-3D. Им пользуется подавляющее большинство людей, занимающихся моделированием. Эта программа позволяет рисовать как 3D объекты, так и схемы, например, электрические принципиальные.

Так вот, NanoCAD – это сильно обрезанная версия КОМПАС-3D. Если кто-то работал с КОМПАСом, то интерфейс этой программы ему покажется очень знакомым.

Здесь есть те же объекты, те же инструменты, те же настройки. Только специализированных инструментов и возможностей для тонкой настройки нет.

Если же Вы никогда не имели дело с какими-либо программами для черчения, то советуем Вам начать знакомство с удивительным миром моделирования со SketchUp, затем перейти на NanoCAD, а потом уже и на КОМПАС-3D. 

Вот несколько особенностей NanoCAD:

  • Стандартные настройки объектов – координаты вершин, толщина и тип линий, ширина, длина и другие параметры размеров и тому подобное. Тонкой настройки, как мы говорили выше, здесь нет.
  • Возможность настроить интерфейс под себя. Как и в КОМПАСе, в NanoCAD легко можно убрать или добавить какую-то панель инструментов.
  • Интерфейс также на русском языке. Программа полностью бесплатная.

 

Рис. №2. NanoCAD

Многие советуют начинать работать с чертежами именно в NanoCAD, так как это отличная и бесплатная альтернатива КОМПАСу.

Ссылка на скачивание 

3. A9CAD

Еще один прекрасный набор инструментов, который многие специалисты советуют начинающим.

Конечно, A9CAD не настолько прост как SketchUp, но все же за несколько дней его вполне можно освоить и начать делать несложные чертежи.

Данная программа работает только с форматами DWG и DXF, причем файлы должны быть созданы тоже в A9CAD. Если они будут сделаны в том же КОМПАСе, то здесь их не откроешь. По крайней мере, это будет весьма затруднительно. 

Имеется вполне стандартный набор инструментов. Конечно, опытным юзерам или тем, кто хочет научиться чертить профессионально, этого не хватит.

Здесь есть инструменты для рисования окружности, дуги, линии, квадрата/прямоугольника и кривой, а также для нанесения точек. Ниже есть кнопка для нанесения текста и изменения цвета.

Конечно, измерить расстояние, копировать фигуру и выполнять подобные действия здесь тоже можно. А вот выполнять настройку самих объектов уже не получится.

Другие особенности A9CAD такие:

  • Есть возможность напечатать полученный чертеж.
  • Программа полностью бесплатная, но интерфейс английский.
  • Дополнительных функций и модулей расширения здесь нет и не будет. 

 

Рис. №3. A9CAD

Ссылка на скачивание 

4. ABViewer

Преимущество ABViewer состоит в том, что интерфейс здесь выполнен в духе программ от Microsoft. Имеется в виду офисный пакет, то есть Word, PowerPoint, Excel и так далее. Некоторые даже думают, что ABViewer – это тоже часть офисного ПО от создателей Windows.

Все основные элементы собраны вверху. Они поделены на определенные категории.

К примеру, если раскрыть блок «Рисование», можно будет увидеть инструмент для нанесения той же прямой или кривой линии, прямоугольника, окружности и других фигур. Есть также блок «Текст», который дает возможность добавить на чертеж текст в формате WordArt или в одном из обычных шрифтов.

Что касается непосредственно черчения, то этот процесс здесь проходит максимально просто и гладко. Есть минимальные возможности для настройки объектов.

Так пользователь может вручную ввести координаты X, Y, длину, угол и отслеживание. С этим все очень хорошо, но, опять же, только для начинающих юзеров.

Еще несколько особенностей ABViewer:

  • Есть широкие возможности для работы с разными форматами. Чертежи можно даже конвертировать из одного формата в другой.
  • Набор инструментов экспертами оценивается как средний, то есть его хватит полупрофессиональным специалистам, а тем более новичкам.
  • Русский интерфейс. Программа платная, но есть пробный период в 45 дней. За это время программу вполне можно освоить целиком и перейти на что-то более сложное. 

 

Рис. №4. ABViewer

Ссылка на скачивание 

5. FreeCAD

И еще одна максимально простая в использовании программа с большими и яркими инструментами (имеется в виду изображения инструментов в окне FreeCAD).

По функционалу FreeCAD очень похож на AutoCAD, еще один гигант в мире моделирования и черчения. При этом множество функций и тех же инструментов взяты именно от AutoCAD. Поэтому Вы вполне можете использовать FreeCAD в своей работе, хорошенько его освоить, а потом уже переходить на AutoCAD или даже на КОМПАС.

Возможность работать в 3D здесь отсутствует. Зато 2D чертежи получаются отменными. После создания их можно открывать в любой другой подобной программе.

Можно вводить вручную координаты каждого объекта, его длина и угол. Интересно, что кроме координат X и Y,здесь также можно ввести и Z.

Другие интересные моменты в работе FreeCAD таике:

  • Хорошо проработана работа с макросами, то есть небольшими подпрограммами, которые выполняют одни и те же действия.
  • Огромное количество форматов для чтения и сохранения чертежей.
  • Интерфейс не на русском языке, зато программа тоже бесплатная.

 

Рис. №5. FreeCAD

Ссылка на скачивание

Если Вы знаете еще более простые программы для черчения, пишите о них в комментариях. А ниже Вы можете видеть один из уроков по работе в самой простом наборе инструментов для моделирования, SketchUp.

Отзывы

Как нарисовать схему в ворде

Вам понадобится

  • Компьютер
  • Microsoft Office Word 2007 (2003)
  • Навыки начинающего пользователя

Инструкция

Произвольную схему можно нарисовать при помощи фигур, сочетая их со стрелками и другими специальными знаками. Приемы работы с фигурами.Нажмите на кнопку «Фигуры». Появится список возможных объектов. Выберите любой одним кликом левой кнопкой мыши. Затем перенесите указатель мыши на лист. Вместо стрелочки появится крестик. Зажмите левую кнопку мыши и растягивайте фигуру до нужных размеров.

Размер фигуры регулируется с помощью синих точек контура. Наведите указатель на такую точку, он превратится в двунаправленную стрелку. Зажмите левую кнопку мыши и тяните контур вправо или влево. С помощью зеленой точки на верхней границе контура можно повернуть фигуру. Наведите указатель мыши на точку, поворот отобразится круглой стрелкой. Подвигайте мышью и приведите объект в нужное положение.

У некоторых фигур есть желтая точка для изменения очертаний (размаха стрелки, длины выноски). Наведите на нее указатель мыши, «зацепитесь» левой кнопкой и потяните.

Чтобы переместить фигуру, наведите на нее указатель мыши, он превратится в крестообразную стрелку, зажмите левую кнопку и перетаскивайте контур в нужное место. Чтобы скопировать фигуру, нажмите и удерживайте клавишу Ctrl, одновременно левой кнопкой мыши перетаскивая ваш объект, затем отпустите кнопку.

Чтобы скопировать несколько фигур, для начала выделите их при помощи клавиши Ctrl: зажмите ее и мышью покликайте нужные фигуры. Не снимая выделения, перетащите группу.

Чтобы зафиксировать несколько фигур во избежание случайного смещения, их следует группировать. Выделите группу при помощи клавиши Ctrl, как в пункте 3. Затем на выделенных объектах кликните правой кнопкой, в контекстном меню выберите команду «Группировать». Если вы пожелаете поменять расположение фигур, разгруппируйте их: нажмите на группе правой кнопкой мыши и в меню выберите команду «Разгруппировать».

Чтобы ввести текст в фигуру, кликните на ней правой кнопкой мыши и в контекстном меню выберите команду «Добавить текст».

Сразу же после вставки фигуры в ленте открывается вкладка Средства рисования – Формат. Применяйте к выделенному объекту различные параметры: цвет, объем, тень, контур – всё можно настроить вручную. Создать схему можно также при помощи SmartArt.Приемы работы с объектами SmartArt.

На вкладке Вставка выберите SmartArt. Откроется окно выбора объектов. В левой части окна перечислены типы схем. В центре даны их разновидности, и любая по клику отображается в правой части. Поскольку каждая разновидность объекта имеет свое предназначение, под эскизом дается небольшое пояснение, чтобы вам легче было сделать выбор.

Наиболее распространенным и удобным макетом для создания схемы является Иерархия. Выберите объект и нажмите ОК. На листе появится макет с несколькими блоками, расположенными в вертикальной иерархии: главным, помощником и тремя подчиненными (которые являются «коллегами», то есть равноправны между собой).

Блоки можно удалять или добавлять. Чтобы удалить блок, кликните по нему, затем нажмите Delete или Backspace.

Чтобы добавить блок, нажмите правой кнопкой мыши в том прямоугольнике, относительно которого собираетесь добавлять. В контекстном меню выберите команду Добавить фигуру, затем конкретизируйте, где именно: выше или ниже, до или после

Чтобы ввести текст в блок, просто кликните по слову «Текст» и начинайте печатать. Другой способ – ввод в области текста. Найдите выступ слева на контуре схемы, кликните по нему. Отобразится маркированный список с отдельной строкой для каждого блока.

Меню объектов SmartArt располагает богатым выбором элементов стиля. Сразу после вставки объекта открывается вкладка Работа с объектами SmartArt. Там можно настроить вид, положение в пространстве, тень, цвет и пр.

Обратите внимание

Данная инструкция рассчитана на версию 2007 года. В 2003 нет SmartArt, а фигуры находятся на панели рисования, под кнопкой «Автофигуры».Организационную диаграмму ищите в меню Вставка – Схематическая диаграмма.

Полезный совет

Прежде чем приступить к составлению схемы на компьютере, набросайте ее на листочке. Продумайте оптимальный вариант расположения элементов структуры, чтобы при создании схемы не делать лишних движений.

Источники:

  • Как рисовать схемы в Word
  • как нарисовать схему слова
  • Как рисовать в Word 2013

Если вышивка — ваше любимое хобби, то наверняка вы не раз задавались вопросом: где достать интересные схемы и как сделать схему для вышивки из понравившихся картин и рисунков? Покупать схемы не всегда выгодно — наборы для вышивки довольно дороги. Но если у вас есть Photoshop и специальная программа для создания схем, вы можете создать схему из любого изображения: из рисунка, фотографии, орнамента и др.

Вам понадобится

Инструкция

Откройте в Фотошопе изображение, которое вы хотите превратить в схему. Подготовьте его к изменениям. Схема вышивки по размеру должна быть близка к оригиналу, поэтому измените размер картинки так, чтобы она была не слишком большой. Скадрируйте изображения и отрежьте инструментом «Crop» по периметру все ненужное, оставив только рисунок, который вы хотите сделать схемой. Далее посмотрите, какое разрешение у вашего рисунка. В зависимости от того, какой размер вы желаете получить, уменьшайте разрешение, высоту и ширину. В готовой вышивке будет столько стежков, сколько пикселей в вашем изображении, поэтому не смущайтесь получившейся маленькой картинкой.

Сделайте цветокоррекцию — откройте «Levels» и сделайте цвета насыщеннее и ярче. Для увеличения резкости воспользуйтесь фильтром «Sharp».

Теперь, когда картинка подготовлена, откройте программу для создания схем (например, PCStitch или другую). Нажмите «Файл» > «Импорт» и откройте рисунок, с которым вы работали в Фотошопе. Укажите размер вышивки — ее высоту и ширину в стежках. В разделе «Cloth Count» укажите количество стежков на дюйм.

В программе для вышивки вы можете дополнительно откорректировать яркость и насыщенность, если не сделали этого в Фотошопе. Затем укажите количество цветов, которые вы реально будете использовать в вышивке. Не рекомендуется брать слишком много — выберите не более 20-30 цветов.

Если у вас уже есть достаточное количество ниток для вышивки разных цветов, попробуйте предложить собственную палитру программе. Для этого откройте в опциях «Floss Palette» и оредактируйте палитру цветов. Добавляйте цвета, которые у вас есть, и убирайте те, которых у вас нет. Сохраните палитру с разрешением FLS, а затем загрузите ее и в предварительном просмотре убедитесь, что получившийся вариант на картинке со схемой вас устраивает, а значит, вы можете использовать собственные нитки. Если не устраивает, добавьте дополнительные цвета.

Ваша схема подготовлена — можете начинать вышивать ее на канве.

Видео по теме

План комнаты бывает необходим при перепланировке самой комнаты, при расстановке новой или перестановке старой мебели. Сейчас существуют различные компьютерные программы для составления плана квартиры, но проще сделать это обычным способом – с помощью карандаша, линейки и рулетки.

Вам понадобится

  • – рулетка;
  • – обычная и миллиметровая бумага;
  • – карандаш и ластик;
  • – линейка.

Инструкция

Для начала начертите примерный план комнаты. Не обязательно соблюдать нужные пропорции. Представьте, что видите комнату сверху. Изобразите ее форму.

Возьмите рулетку и измерьте размеры комнаты. Результаты измерения пометьте на чертеже. Отметьте важные детали, такие как дверь, окна, радиатор. Отметьте расположение всех электрических розеток, выключателя и светильника. Та область, которую занимает дверь при ее открытии, обычно изображается дугой.

Далее измерьте всю мебель, окна и другие объекты. Их размеры также перенесите на предварительный чертеж. Их высота вам не понадобится, поэтому измеряйте только длину и ширину. Измерьте высоту комнаты и обведите в кружок возле чертежа.

Возьмите миллиметровую бумагу и линейку. Теперь нужно нарисовать ровный и аккуратный план комнаты, соблюдая все необходимые пропорции. Выберите соотношение размеров реальных объектов с их размерами на чертеже. Обычно выбирают масштаб 1:20. Этого будет вполне достаточно. Рассчитайте размеры объектов на чертеже. Для этого их реальный размер в миллиметрах разделите на 20.

На миллиметровой бумаге начертите периметр комнаты с помощью карандаша и линейки. Аккуратно перенесите изображения окон, мебели, двери и электрических розеток на бумагу. Не забывайте соблюдать соотношение размеров. Дугу, которая изображает область открытия дверей, можно нарисовать с помощью циркуля.

Когда все объекты перенесены на миллиметровку, ластиком уберите все лишние линии и неровности. Пометьте высоту комнаты и используемый масштаб.

Обратите внимание

Вместо того чтобы подписывать на чертеже объекты, можно вынести их обозначения и подписать. Так же можно сделать и с числами. Каждый однотипный объект помечается своим числом, а оформить обозначения можно в виде сноски.

Полезный совет

Подпишите все объекты и их реальные размеры, чтобы потом не гадать, что подразумевается под каждым конкретным прямоугольником.

Собравшись строить дом или дачу, первым делом продумайте, чего же вы хотите и как себе представляете будущее строение. Начертите его план. План может понадобиться и в том случае, если собрались что-то изменить внутри дома или сделать внешнюю пристройку.

Вам понадобится

  • Рулетка
  • Карандаш
  • Линейка
  • Угольник
  • Лист бумаги

Инструкция

Проведите необходимые измерения. Вам нужно знать длину и ширину строения. Если вы только собрались строить дом, придумайте, каких он должен быть размеров.

Проведите на листе оси. Учтите, что ось будет располагаться посередине несущей стены. Соответственно, расстояние между осями соответствует промежутку между стенами.

Промаркируйте оси. Вертикальные оси обозначьте цифрами, а горизонтальные — русскими буквами.

Прорисуйте по осям стены жирной линией. Обозначьте дверной проем.

Нанесите внутренние стены и перегородки.

Обозначьте двери и окна, а также направление, в котором они открываются. Перегородки заштрихуйте. Окна и двери пронумеруйте.

Обозначьте кухню, ванную, туалет и другие помещения, в которых есть необходимое оборудование или предполагается его установка.

Обозначьте лестницы, вентиляционные шахты, отметку уровня пола.

Присвойте каждому помещению экспликационный номер и обозначьте его цифрой в кружочке.

Сделайте таблицу экспликации. Внесите в нее все помещения в порядке нумерации.

Видео по теме

Обратите внимание

Бумагу лучше всего брать миллиметровую.Удобнее заранее выбрать масштаб и чертить план в соответствии с ним.

Все линии проводите строго по линейке. Если в доме есть какие-то помещения, скажем, круглой или овальной формы – не рисуйте их от руки, а пользуйтесь чертежными инструментами.

Полезный совет

На плане участка необходимо обозначить и пронумеровать все строения, дорожки, колодец. Можно обозначить также различные зоны — сад, огородные грядки и прочее.

По мере появления на плане каждой линии сразу же проставляйте размер обозначенного ею объекта. Это сэкономит массу времени.

Квартира – вид жилого помещения, который состоит из одной или нескольких комнат и имеет отдельный вход. Для постройки и дальнейшего использования квартиры нужен план, т.е. расположение ее помещений. Как же правильно его нарисовать?

Вам понадобится

  • бумага, карандаш и ластик.

Инструкция

Нарисуйте однокомнатную квартиру. Для этого сначала изобразите прямоугольник, у которого все стороны почти одинаковые. Верхнюю часть отделите горизонтальной полосой. Это будет изображение балкона. Нижнюю часть прямоугольника разделите пополам вертикальной линией. В правой части квартиры расположите комнату. Ее верхняя граница будет символизировать стену, имеющую выход на балкон. Для изображения двери отступите от левого края стены на расстояние, равное ее пятой части. Теперь от этой точки вниз нарисуйте косую линию. Промежуток между дверью и стеной обозначьте небольшой дугой. Таким образом, становится понятно, в какую сторону открывается дверь. В левой части плана квартиры, расположите коридор, ванную комната и кухню. Кухня занимает верхнюю половину левой части квартиры. Обязательно нарисуйте символическую кухонную плиту в виде квадрата с четырьмя темными кругами.

Ниже кухни расположите совмещенный санузел. Он представляет собой квадрат, стена которого примерно в 2 раза короче стены кухни. Квадрат примыкает лишь одной стороной к стене квартиры. Схематически изобразите ванну в виде прямоугольника. Расположите рядом умывальник в виде маленького прямоугольника и унитаз в виде овала. В ванной комнате, кухне, в стене, а также между коридором и комнатой входную дверь нарисуйте по аналогии с дверью балкона.

В каждом из помещений напишите цифры, обозначающие количество квадратных метров. При окончательном оформлении прорисуйте жирной линией места расположения окон. Также заштрихуйте площадь балкона. При изображении плана квартиры придерживайтесь пропорций. Т.е. площадь комнаты в 18 квадратов, визуально не может быть меньшей, чем кухня в 8 квадратных метров.

Видео по теме

Источники:

Схемы используются для наглядного представления информации в текстовых документах: учебниках, статьях, различных методических пособиях. Ее построение возможно в различных программах. Простейшую можно сделать с помощью приложения Word.

Инструкция

Запустите программу Microsoft Word, создайте новый документ, чтобы сделать схему. Выполните команду «Вид» – «Панели инструментов» и установите флажок напротив панели инструментов «Рисование». Она появится внизу экрана, над строкой состояния. Приступите к созданию схемы.

Перейдите в меню «Автофигуры», чтобы нарисовать структуру вашей схемы. Например, перейдите в раздел «Основные», выберите прямоугольник, установите курсор в том месте документа, где должна начинаться ваша схема и удерживая левую клавишу мыши, потяните прямоугольник вправо и вниз. Далее щелкните правой кнопкой мыши по объекту и выберите команду «Добавить текст». Введите нужные символы. Аналогично добавьте другие структурные элементы схемы с помощью основных фигур и фигур, содержащихся в меню «Блок-схемы».

Выполните соединение элементов схемы с помощью линий и стрелок, для этого используйте соответствующие инструменты на панели «Рисование». После добавления всех необходимых элементов оформите их: выполните заливку, добавьте при необходимости тень, объем, установите размер соединительных линий с помощью кнопок на панели инструментов «Рисование».

После этого, чтобы завершить создание схемы в документе, выберите на панели инструмент «Выбор объектов» (стрелка белого цвета) и выделите всю вашу схему, далее выберите пункт меню «Рисование» – «Группировать». Ваша схема станет единым рисунком, скопируйте его в буфер обмена и вставьте в нужный документ. Для изменения отдельных элементов схемы аналогично выделите ее и выберите команду «Разгруппировать».

Создайте схему в электронной презентации с использованием программы Power Point. Добавьте новый слайд для схемы, на панели инструментов выберите команду «Организационная диаграмма». Выберите внешний вид схемы, нажмите «ОК».

Заполните шаблон схемы текстом, чтобы добавить элементы в схему, щелкните по любому из них, на панели инструментов диаграммы выберите команду «Добавить фигуру» и выберите ее тип. Также можно изменить внешний вид схемы с помощью команды «Макет» и «Авто формат».

Полезный совет

Перед созданием схемы в электронном виде сделайте сначала ее заготовку на бумаге – это упростит вам задачу.

Конструкторская работа немыслима без чертежей. Их можно чертить от руки, на это уходит довольно много времени. Данную работу можно значительно облегчить, используя специализированные компьютерные программы.

Инструкция

При создании чертежей можно пользоваться разными программами, конкретный выбор зависит от того, в какой области вы работаете и какого рода чертеж вам нужен. Одной из самых известных программ для компьютерного проектирования является САПР AutoCAD. Данная программа позволяет создавать проекты любой сложности, распечатывать готовые чертежи. Она подходит для подавляющего большинства проектных работ, ее последние версии поддерживают 3D-моделирование.

Несмотря на все достоинства AutoCAD, в некоторых случаях конструктору нужны более специализированные программы. Например, если вы хотите создать чертеж яхты, следует поискать программы, созданные специально для этих целей. Они помогут легко и быстро подготовить необходимые чертежи, с их помощью вы сможете просчитать специфические судостроительные задачи – например, остойчивость будущего судна, его осадку и дифферент.

Для проектирования яхт вы можете воспользоваться следующими специализированными программами: AutoShip, Rhinoceros, AutoYacht, CATIA, Freeship, CARENE. Все эти программы можно найти в интернете. Лучше всего они подходят для самодеятельных конструкторов, так как достаточно просты в освоении, позволяют быстро просчитать различные варианты конструкции и создать рабочие чертежи. Можно использовать и очень хорошую программу 3D-моделирования КОМПАС, активно применяемую в самых разных областях конструкторской деятельности.

Замечательными качествами обладает система автоматического проектирования SolidWorks. Она позволяет работать с самыми сложными проектами, при этом конструктор получает возможность создавать твердотельные 3D-модели деталей и узлов разрабатываемой конструкции. В этой программе очень приятно работать, по готовой объемной детали легко создается рабочий чертеж. Достоинство программы в том, что при изменении компоновки узлов или размеров деталей оставшиеся размеры автоматически подгоняются под новый вариант, что избавляет конструктора от массы утомительной работы. SolidWorks, наряду с AutoCAD, является лидером на рынке автоматических систем проектирования.

Как нарисовать электрическую схему на компьютере — обзор программ

Главная » Электрика » Как нарисовать электрическую схему на компьютере — обзор программ

Мы все больше пользуемся компьютером и виртуальными инструментами. Вот уже и чертить на бумаге схемы не всегда хочется — долго, не всегда красиво и исправлять сложно. Кроме того, программа для рисования схем может выдать перечень необходимых элементов, смоделировать печатную плату, а некоторые могут даже просчитать результаты ее работы. 

Бесплатные программы для создания схем

В сети имеется немало неплохих бесплатных программ для рисования электрических схем. Профессионалам их функционала может быть недостаточно, но для создания схемы электроснабжения дома или квартиры, их функций и операций хватит с головой. Не все они в равной мере удобны, есть сложные в освоении,  но можно найти несколько бесплатных программ для рисования электросхем которыми сможет пользоваться любой, настолько в них простой и понятный интерфейс.

Самый простой вариант — использовать штатную программу Windows Paint, которая есть практически на любом компьютере. Но в этом случае вам придется все элементы прорисовывать самостоятельно. Специальная программа для рисования схем позволяет вставлять готовые элементы на нужные места, а потом соединять их при помощи линий связи. ОБ этих программах и поговорим дальше.

Бесплатная программа для рисования схем — не значит плохая. На данном фото работа с Fritzing

Редактор электрических схем QElectroTech

Программа для рисования схем QElectroTech есть на русском языке, причем русифицирована она полностью — меню, пояснения — на русском языке. Удобный и понятный интерфейс — иерархическое меню с возможными элементами и операциями в левой части экрана и несколько вкладок вверху. Есть также кнопки быстрого доступа для выполнения стандартных операций — сохранения, вывода на печать и т.п.

Редактор электрических схем QElectroTech

Имеется обширный перечень готовых элементов, есть возможность рисовать геометрические фигуры, вставлять текст, вносить изменения на определенном участке, изменять в каком-то отдельно взятом фрагменте направление, добавлять строки и столбцы. В общем, довольно удобна программа при помощи которой легко нарисовать схему электроснабжения, проставить наименование элементов и номиналы. Результат можно сохранить в нескольких форматах: JPG, PNG, BMP, SVG, импортировать данные (открыть в данной программе) можно в форматах  QET и XML, экспортировать — в формате QET.

Недостаток этой программы для рисования схем — отсутствие видео на русском языке о том, как ей пользоваться, зато есть немалое количество уроков на других языках.

Графический редактор от Майкрософт — Visio

Для тех, кто имеет хоть небольшой опыт работы с продуктами Майкрософт, освоить работу в из графическом редакторе Visio (Визио) будет несложно. У данного продукта также есть полностью русифицированная версия, причем с хорошим уровнем перевода.

Составлять электрические схемы в Visio несложно

Данный продукт позволяет начертить схему в масштабе, что удобно для расчета количества необходимых проводов. Большая библиотека трафаретов с условными обозначениями, различных составляющих схемы, делает работу похожей на сборку конструктора: необходимо найти нужный элемент и поставить его на место. Так как к работе в программах данного типа многие привыкли, сложности поиск не представляет.

К положительным моментам можно отнести наличие приличного количества уроков по работе с этой программой для рисования схем, причем на русском языке.

Компас Электрик

Еще одна программа для рисования схем на компьютере — Компас Электрик. Это уже более серьезный продукт, который используют профессионалы. Имеется широкий функционал, позволяющий рисовать различные планы, блок-схемы, другие подобные рисунки. При переносе схемы в программу параллельно формируется спецификация и монтажная схема и све они выдаются на печать.

Для начала работы необходимо подгрузить библиотеку с элементами системы. При выборе схематичного изображения того или иного элемента будет «выскакивать» окно, в котором будет список подходящих деталей, взятый из библиотеки. Из данного списка выбирают подходящий элемент, после чего его схематичное изображение появляется в указанном месте схемы. В то же время автоматически проставляется соответствующее ГОСТу обозначение со сквозной нумерацией (цифры программа меняет сама). В то же время в спецификации появляются параметры (название, номер, номинал) выбранного элемента.

Пример схемы, созданной в Компас Электрик

В общем, программа интересная и полезная для разработки схем устройств. Может применяться для создания схемы электропроводки в доме или квартире, но в этом случае ее функционал использован почти не будет. И еще один положительный момент: есть много видео-уроков работы с Компас-Электрик, так что освоить ее будет несложно.

Эта программа полезна не только для рисования схем электроснабжения — тут все просто, так как нужна только схема. Более полезна она для разработки плат, так как имеет встроенную функцию преобразования имеющейся схемы в трассу для печатной платы.

Исходная схема (мультивибратор), нарисованная а DipTrace Схема печатной платы Сама плата мультивибратора

Для начала работы, как и в многих других случаях, необходимо сначала подгрузить имеющиеся на вашем компьютере библиотеки с элементной базой. Для этого необходимо запустить приложение  Schematic DT, после чего можно загрузить библиотеки. Их можно будет скачать на том же ресурсе, где будете брать программу.

После загрузки библиотеки можно приступать к рисованию схемы. Сначала можно «перетащить» нужные элементы из библиотек на рабочее поле, развернуть их (если понадобится), расставить и связать линиями связи. После того как схема готова, если необходимо, в меню выбираем строку «преобразовать в плату» и ждем некоторое время. На выходе будет готовая печатная плата с расположением элементов и дорожек. Также можно в 3D варианте посмотреть внешний вид готовой платы.

Бесплатная прога ProfiCAD для составления электросхем

Бесплатная программа для рисования схем ProfiCAD — один из лучших вариантов для домашнего мастера. Она проста в работе, не требует наличия на компьютере специальных библиотек — в ней уже есть коло 700 элементов. Если их недостаточно, можно легко пополнить базу. Требуемый элемент можно просто «перетащить» на поле, там развернуть в нужном направлении,  установить.

Пример использования ProfiCAD для рисования электрических схем

Отрисовав схему, можно получить таблицу соединений, ведомость материалов, список проводов. Результаты можно получить в одном из четырех наиболее распространенных форматов: PNG, EMF, BMP, DXF.  Приятная особенность этой программы — она имеет низкие аппаратные требования. Она нормально работает с системами от Windows 2000 и выше.

Есть у этого продукта только один недостаток — пока нет видео о работе с ней на русском языке. Но интерфейс настолько понятный, что разобраться можно и самому, или посмотреть один из «импортных» роликов чтобы понять механику работы.

 Платные, на которые стоит потратиться

Если вам придется часто работать с программой для рисования схем, стоит рассмотреть некоторые платные версии. Чем они лучше? У них более широкий функционал, иногда более обширные библиотеки  и более продуманный интерфейс.

Простая и удобная sPlan

Если вам не очень хочется разбираться с тонкостями работы с многоуровневыми программм, присмотритесь к пролукту sPlan. Он имеет очень простое и понятное устройство, так что через час-полтора работы вы будете уже свободно ориентироваться.

Как обычно в таких программах, необходима библиотека элементов, после первого пуска их надо подгрузить перед началом работы. В дальнейшем, если не будете переносить библиотеку в другое место, настройка не нужна — старый путь к ней используется по умолчанию.

Программа для рисования схем sPlan и ее библиотека

Если вам необходим элемент, которого нет в списке, его можно нарисовать, затем добавить в библиотеку. Также есть возможность вставлять посторонние изображения и сохранять их, при необходимости, в библиотеке.

Из других полезных и нужных функций — автонумерация, возможность изменения масштаба элемента при помощи вращения колесика мышки, линейки для более понятного масштабирования. В общем, приятная и полезная вещь.

Micro-Cap

Эта программа кроме построения схемы любого типа (аналогового, цифрового или смешанного) позволяет еще и проанализировать ее работу. Задаются исходные параметры и получаете выходные данные. То есть, можно моделировать работу схемы при различных условиях. Очень полезная возможность, потому, наверное, ее очень любят преподаватели, да и студенты.

В программе Micro-Cap есть встроенные библиотеки, которые можно пополнять при помощи специальной функции. При рисовании электрической схемы продукт в автоматическом режиме разрабатывает уравнения цепи, также проводит расчет в зависимости от проставленных номиналов. При изменении номинала, изменение выходных параметров происходит тут же.

Программа для черчения схем электроснабжения и не только — больше для симуляции их работы

Номиналы элементов могут быть постоянными или переменными, зависящими от различных факторов — температуры, времени, частоты, состояния некоторых элементов схемы и т.д. Все эти варианты просчитываются, результаты выдаются в удобном виде. Если есть в схеме детали, которые изменяют вид или состояние — светодиоды, реле — при симуляции работы, изменяют свои параметры и внешний вид благодаря анимации.

Программа для черчения и анализа схем Micro-Cap платная, в оригинале — англоязычная, но есть и русифицированная версия. Стоимость ее в профессиональном варианте — больше тысячи долларов. Хороша новость в том, что есть и бесплатная версия, как водится с урезанными возможностями (меньшая библиотека, не более 50 элементов в схеме, сниженная скорость работы). Для домашнего пользования вполне подойдет и такой вариант. Приятно еще что она нормально работает с любой системой Windows от Vista и 7 и выше.

Как нарисовать схемы в Word 2003

11:38       Людвиг      Главная страница » Word      Просмотров:   9777

Как нарисовать схемы в Word 2003? Для того, что бы рисовать схемы в Word, вам понадобиться только ваша фантазия, желание, и сама программа – текстовый редактор, который входит в пакет офисных программ от Microsoft. Попробовав один раз, вы уже сможете создавать любые схемы и небольшие топографические схемы. В дальнейшем я научу вас делать и это. Вы увидите, что в хороших руках из текстового редактора и цветного принтера можно сделать целую мини-типографию.

Как нарисовать схемы в Word

Прежде чем создавать схемы в Word неплохо было бы научиться изменять цвет страницы, создавать красивые рамки, и пользоваться WordArt.

Откройте новый документ: — Пуск – Программы – Microsoft Office — Microsoft Office Word . Внизу на панели – Рисование – выбираем иконку – Прямоугольник .

Если у вас нет этой панели, то зайдите в меню – Вид – Панели инструментов – и выберите – Рисование.

После того, как вы кликнули мышкой по иконке – Прямоугольник – у вас появится такая рамочка.

Кликните в любом месте вновь созданного поля. Поле примет вот такой вид.

Этот квадратик в центре можете вырезать (щелкните на нем правой кнопкой мыши и в выпадающем меню выберите – Вырезать -). Выделите прямоугольник, в котором мы будем рисовать. На панели – Рисование – откройте – Автофигуры – Основные фигуры – Куб – и кликнете мышкой на поле выделенного прямоугольника.

У вас должна получиться, вот такая картинка.

Вы можете перемещать и изменять размер этого куба. Для этого кликните по этому кубику, чтобы выделить его. Если при наведении мышкой на этот кубик курсор принимает вид крестика со стрелочками на концах, значит, этот предмет можно переместить. Если же курсор принимает вид двунаправленной стрелки (на узелках, которые обозначены маленькими кружочками), значит можно изменить размер объекта. Сделайте из куба прямоугольную фигуру.

Кликните по новой фигуре правой кнопкой мыши и в выпадающем меню выберите пункт – Копировать.

Потом кликните правой кнопкой мыши на свободном поле рядом с фигурой и выберите – Вставить. Проделайте этот трюк дважды.

Уже готовые необходимые вам фигуры можно выбрать из панели — Рисование – Автофигуры – Другие автофигуры.

Должно получиться вот так.

Теперь перетащите эти фигуры как у меня.

Следующую фигуру попробуйте сделать сами (опять же методом копирования).

Сюда же можно вставлять и небольшие рисунки извне, например иконки. Просто берёте нужную вам иконку и копируете или перетаскиваете её на место. Вот что у нас получилось.

Теперь подпишем наши рисунки. Для этого выделите рамку с рисунками (кликните на свободном от рисунков месте, чтобы появилась рамочка) и выберите на панели  Рисование  иконку  Надпись.

Теперь кликните мышкой на свободном поле рамочки. Должно получиться вот так.

У нас появилась новая маленькая рамочка с курсором. В ней мы и будем писать. Размер этой рамочки также можно изменять.

 Создайте методом копирования такие же надписи как у меня и переместите их по местам.

Теперь нарисуем соединительные линии. Для этого в Автофигурах (на панели – Рисование -) выбираем – Соединительные линии. Не забывайте перед выбором выделять главную рамку. Можно её назвать «Холст». Ведь мы рисуем на ней как на холсте. Я в качестве соединительной линии выбрала – Уступ со стрелкой.

Вот тут вам придётся набраться терпения и потренироваться. Наводите курсор в виде крестика на то место откуда собираетесь вести линию и щелкаете не отпуская левой кнопки мыши, тянете линию до того места куда вам нужно и только тогда отпускаете кнопку мыши.

Если не получилось, то отмените ваше действие и опять выберите соединительную линию и начните сначала. Каждую новую линию необходимо заново выбирать на панели – Рисование.

Линии можно изменять, потянув за желтые ромбики на них.

Теперь сделаем симпатичный фон нашему рисунку. Для этого опять выделяем наш «холст» и выбираем всё на той же панели иконку – Цвет заливки.

Выбрав необходимый цвет, щелкните по иконке ещё раз и второй щелчок сделайте уже на свободном поле «холста». Или сначала щелкните по «холсту», а потом по иконке заливки.

Вот, что у нас получилось.

Чтобы наши отдельные рисунки и иконки не смещались в разные стороны, необходимо каждый элемент (и соединительные линии тоже) выделить (щелкайте по каждому элементу, удерживая клавишу «Ctrl», пока не выделите все элементы). Тут тоже придется попотеть. Даже у меня не всегда с первого раза получается.

Теперь аккуратно щелкните правой кнопкой мыши на каком-нибудь выделенном элементе (например, на иконке монитора) и выберите – Группировка – Группировать.

Потренируйтесь немного и вы запросто сможете быстро и легко создавать любые схемы в Word.

Примечание

Кстати, толщину всех линий можно менять. Для этого выделите необходимую линию, щелкнув по ней и выберите на панели – Рисунок – иконку – Тип линии. Но это необходимо делать до группировки. Рамочки с надписями тоже можно залить любым цветом (можно и после группировки).

С уважением, Людмила

Полезные инструменты для рисования электрических цепей • Smashing Robotics

Перед реализацией схемы графическое представление приносит выгоду, но также и недостатки для разработчиков. Положительным моментом является графическое представление электронных схем, позволяющее получить представление об используемых компонентах и ​​способах их подключения. Такое представление также является отличным способом привлечь внимание к деталям, требующим изменений, которые увеличили бы стоимость производства и время, необходимое для создания прототипа физической схемы.

Отрицательная сторона, чувствительность схемы может повлиять на результат работы, например, внешний шум не может быть полностью известен или учтен при создании схем подключения, и это может привести к ошибкам или результатам, не полностью предсказуемым при физической реализации схемы. однако есть несколько программных инструментов, которые предлагают довольно точные функции моделирования. В этой статье вы можете найти обзор программных инструментов САПР, предназначенных для создания и изменения электрических схем, принципиальных схем, а также для проектирования готовых к производству модулей печатных плат.

1. Fritzing


Fritzing – это инициатива в области аппаратного обеспечения с открытым исходным кодом, которая может использоваться в образовательных, промышленных или исследовательских целях, которая была начата в Университете прикладных наук в Потсдаме, Германия. Программное обеспечение позволяет документировать существующую схему подключения или монтаж Arduino в виртуальной среде и редактировать ее или даже создавать новую с нуля, благодаря библиотекам уже созданных элементов. Программное обеспечение можно загрузить бесплатно и доступно для ПК, Windows и Mac.

Fritzing – это очень удобная платформа, управляемая сообществом, где поощряется совместное проектирование. Вы также можете заказать специальные печатные платы, изготовленные на основе ваших собственных электронных разработок.

2. EasyEDA

EasyEDA – это бесплатный веб-инструмент для проектирования и моделирования схем, разработанный командой инженеров из Шэньчжэня, Китай. Существуют определенные уникальные функции, которые обычно не встречаются в веб-приложениях, такие как симулятор SPICE, довольно усовершенствованная рабочая среда, возможность импортировать файлы Kicad или Eagle и экспортировать файлы Gerber и Drilling.Доступны обширные библиотеки компонентов и моделей, и пользователи также могут получить доступ к моделям из Adafruit, Seeedstudio или Sparkfun, и это лишь некоторые из них.

3. Upverter

Upverter – это веб-инструмент EDA для онлайн-проектирования схем и печатных плат, созданный тремя выпускниками Университета Ватерлоо, Канада. Стоимость подписки начинается с 99 долларов США в месяц за базовое членство для одного редактора, в то время как полнофункциональный пакет, включающий моделирование, API и возможности создания сценариев, будет стоить около 999 долларов США в месяц.Доступны корпоративные пакеты и бесплатные пробные версии.

4. Программное обеспечение EAGLE PCB


EAGLE (легко применимый графический редактор макетов), созданный CadSoft, представляет собой платформу САПР с несколькими модулями, включая редактор для чертежей схем. Он совместим с Windows, Linux и Mac. Функции инструмента включают список из 999 листов на схему, компоненты добавляются методом перетаскивания или автоматическим созданием платы. Это удобное программное обеспечение с простым интерфейсом, в котором есть все необходимое для построения самой сложной принципиальной схемы.Цена начинается от 140 евро, около 155 долларов США за однопользовательскую лицензию для хобби.

5. EDWinXP


EDWinXP – это программное обеспечение EDA, которое включает в себя модули для рисования, моделирования и тестирования электронных схем и обладает дружественным интерфейсом, который создает трехмерную визуальную среду для вашего проекта. Он имеет 14-дневный бесплатный пробный период и цены от 440 долларов США за базовую некоммерческую лицензию.

6. NI Multisim


Multisim от National Instruments – это профессиональный продукт, разработанный National Instruments, подходящий для образовательных или промышленных целей и предлагающий поддержку для подробного анализа конструкции и ее характеристик.

7. Принципиальная схема

Принципиальная схема
– это бесплатное программное обеспечение для Windows, которое позволяет вам делать именно то, что подразумевает его название, – рисовать принципиальные схемы. Некоторые из доступных компонентов – микроконтроллер, демультиплексор и индуктор, однако могут быть добавлены пользовательские компоненты. Дизайны можно легко публиковать и редактировать с сообществом.

8. KiCad EDA


KiCad EDA – это программный пакет САПР с открытым исходным кодом для рисования электрических цепей, хорошо подходящий для образовательных и промышленных целей.Он совместим с Windows, Linux и Apple OS X.

9. Анализатор цепей PowerVue


PowerVue – это инструмент, созданный Megasys Software, который позволяет не только рисовать электрические схемы, но и рассчитывать токи и падения напряжения на них. Список спецификаций огромен, программное обеспечение можно использовать для оценки схемы при подключении или отключении определенных компонентов, что позволяет эффективно выполнять отладку только на нескольких участках или на схеме в целом.

Это мощное программное обеспечение для электротехники, предназначенное для профессионального использования, которое доступно либо в виде бесплатного программного обеспечения с ограниченной функциональностью, хотя его достаточно для большинства малых и средних проектов, либо в виде полной платной версии по цене 49 долларов США.

10. DipTrace


DipTrace – очень мощный инструмент, используемый для рисования, моделирования и проверки схем. Он также может обеспечить точную 3D-визуализацию проекта. Файлы можно импортировать и экспортировать в другие инструменты EDA.Программное обеспечение бесплатно для некоммерческого использования для Windows, Linux и Mac, а профессиональные лицензии стоят от 75 до 895 долларов США в зависимости от функций.

11. ExpressPCB


ExpressPCB – это бесплатный программный пакет САПР для Windows, состоящий из ExpressSCH – модуля проектирования схем и ExpressPCB – для проектирования собственно печатной платы. Он имеет знакомый интерфейс, который можно использовать для разработки прототипов за короткое время и с минимальными усилиями. Компоненты можно выбрать из длинного списка, и если эскиз имеет большие размеры, его можно разделить на разные листы.Следующим шагом после завершения эскиза является его отправка в инструмент ExpressPCB, который позволяет вам создать проект печатной платы на основе вашей схемы, который также можно экспортировать для изготовления. Производственные услуги также доступны по цене от 51 доллара США.

12. 5Spice


5Spice – это инструмент, предназначенный для использования в проектах средней сложности и не требующий длинного списка компонентов. Интересной частью программного обеспечения является модуль моделирования, который может реагировать на такие проблемы, как шум на компонентах или анализ чувствительности по переменному и постоянному току.Программное обеспечение доступно для Windows и может свободно использоваться в некоммерческих целях или лицензироваться по цене 319 долларов США за одну копию.

13. gEDA


gEDA – это зрелый инструмент САПР, который предлагает набор компонентов, используемых для проектирования электрических цепей, схематического изображения, моделирования, прототипирования и производства. Его можно использовать бесплатно, оно доступно для Linux и Mac OS X. Экспериментальная версия также доступна для Windows.

14. B2.Spice A / D


Благодаря обновленному интерфейсу для размещения ресурсов одним щелчком мыши B2.Spice A / D может моделировать работу и отображать результаты работы электронной схемы. Может также использоваться для тестирования, и более 25 000 цифровых и аналоговых деталей включены в его библиотеку. Программное обеспечение доступно для Windows и может быть куплено за 595 долларов США за лицензию на одного пользователя. Ежемесячный план подписки также доступен для студентов от 10 долларов США в месяц.

15. SimOne


С SimOne вы можете разрабатывать, моделировать и тестировать печатные схемы за короткое время и с высокой точностью.Доступны библиотеки компонентов, а также средство просмотра графиков для отображения результатов моделирования. Заявленная скорость моделирования в 10 раз выше, чем у других аналогичных продуктов, благодаря передовым числовым алгоритмам, используемым в расчетах.

16. AmpereSoft ProPlan


ProPlan – это профессиональный продукт, доступный на немецком и английском языках. Он предоставляет ряд функций для создания сложных принципиальных схем. Он позволяет экспортировать или импортировать файлы в различное программное обеспечение ПЛК и будет работать только с версиями ОС Windows, и можно запросить пробные версии.

17. FreePCB


FreePCB – это программное обеспечение с открытым исходным кодом, которое может использоваться как новичками, так и опытными пользователями, которые пытаются разрабатывать сложные проекты.

Бесплатная программа для рисования электрических схем

  1. Home
  2. Бесплатная программа для рисования электрических схем

Тип фильтра: Все время Последние 24 часа Прошлая неделя Прошлый месяц

Результаты листинга Бесплатное программное обеспечение для построения электрических схем

Загрузите бесплатное программное обеспечение CAD для электрических схем: PCSCHEMATIC

5 часов назад Electrical CAD software .- Бесплатная загрузка . Здесь вы можете загрузить бесплатное программное обеспечение для электричества CAD PCSCHEMATIC Automation 40. Вы можете работать с проектами, содержащими максимум: 10 страниц. 40 электрических символов. 200…

Подробнее